Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate Ac3H11_788 Pyrroline-5-carboxylate reductase (EC 1.5.1.2)
Query= SwissProt::P22008 (273 letters) >lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) Length = 281 Score = 211 bits (537), Expect = 1e-59 Identities = 120/269 (44%), Positives = 165/269 (61%), Gaps = 2/269 (0%) Query: 4 PRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVAD 63 P IAFIG GNMA+++IGGL QG PA+QI +P A R + F + A+ Sbjct: 14 PTIAFIGGGNMASAIIGGLIGQGHPASQIEVVEPYAPTREALLKNFGLTAQPEAGPALQR 73 Query: 64 ADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTP 123 A +VV +VKPQ K A A A P+ L +S+AAGI S+ WLG R VVR MPNTP Sbjct: 74 ASIVVWAVKPQTFKDAA-AQARAHTPQALHLSVAAGIRSDSIAQWLGTER-VVRTMPNTP 131 Query: 124 ALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLL 183 AL+ +G S +YA V+ A+ + ++++ G LW++ E Q+DAVTA+SGSGPAY F Sbjct: 132 ALVGKGMSAIYARPAVTPAERQSVEAIMASTGEFLWVESETQLDAVTALSGSGPAYVFYF 191 Query: 184 MQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKS 243 ++AM AG +GLS A +L + T +GA+++A S PA LR RVTS GTT AA++S Sbjct: 192 LEAMARAGVGMGLSDAQAHQLAVGTFVGASELARRSHEPPAVLRERVTSKGGTTYAALQS 251 Query: 244 FQANGFEALVEQALNAASQRSAELAEQLG 272 +A+G E A+ AA +R+ EL + G Sbjct: 252 MEASGVSQAFEAAMRAAEKRANELGNEFG 280 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 281 Length adjustment: 25 Effective length of query: 248 Effective length of database: 256 Effective search space: 63488 Effective search space used: 63488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate Ac3H11_788 (Pyrroline-5-carboxylate reductase (EC 1.5.1.2))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00112.hmm # target sequence database: /tmp/gapView.14555.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-83 263.9 4.4 1e-82 263.7 4.4 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 Pyrroline-5-carboxylate reductas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.7 4.4 1e-82 1e-82 1 263 [] 16 275 .. 16 275 .. 0.98 Alignments for each domain: == domain 1 score: 263.7 bits; conditional E-value: 1e-82 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvv 63 ia+iG+Gnm++a++ gl+ +g + +++i v+e+ ++ ++al+k++g +++ +a a + a++v lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 16 IAFIGGGNMASAIIGGLIGQGHP-ASQIEVVEPYAPTREALLKNFGLTAQPEAGPALQRASIV 77 89******************988.8************************************** PP TIGR00112 64 llavKPqdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgag 126 + avKPq +++++a+ + +t ++l +S++AG++ + + q+l+ ++rvvR mPNt+a vg+g lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 78 VWAVKPQTFKDAAAQARA--HTPQALHLSVAAGIRSDSIAQWLG-TERVVRTMPNTPALVGKG 137 *************97665..6799*******************7.589*************** PP TIGR00112 127 vtaiaassevseeqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagv 188 ++ai+a+ +v++++++ ve++++++G+ ++ve e +ldavtalsGSgPA+vf+++ea+a+agv lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 138 MSAIYARPAVTPAERQSVEAIMASTGEFLWVEsETQLDAVTALSGSGPAYVFYFLEAMARAGV 200 *************************************************************** PP TIGR00112 189 klGLpreeakelaaqtlkGaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavie 251 +GL+ ++a +la t+ Ga++l +s+e pa+L+++Vts+gGtT a+l+++e++gv +a+++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 201 GMGLSDAQAHQLAVGTFVGASELARRSHEPPAVLRERVTSKGGTTYAALQSMEASGVSQAFEA 263 *************************************************************** PP TIGR00112 252 aveaavkrseeL 263 a++aa kr++eL lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_788 264 AMRAAEKRANEL 275 *********998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory