Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate Ac3H11_1332 Acetylornithine aminotransferase (EC 2.6.1.11)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1332 Length = 398 Score = 270 bits (689), Expect = 7e-77 Identities = 156/365 (42%), Positives = 208/365 (56%), Gaps = 9/365 (2%) Query: 30 RGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHVSNVFTNEPALRL 89 RG G RVWD +G+E ID GGIAVN LGH H LV AL +Q KL H SN + +L Sbjct: 25 RGQGCRVWDVNGKEYIDGLGGIAVNTLGHNHGKLVPALQDQIAKLIHTSNYYHVPLQEKL 84 Query: 90 AHKLVDATFAERVFFCNSGAEANEAAFKLARRVAHDRFGTEKYEIVAALNSFHGRTLFTV 149 A KLV+ + + VFFCNSG EANEAA K+AR+ D+ G K EIV +FHGR++ T+ Sbjct: 85 ATKLVELSGMQNVFFCNSGLEANEAALKIARKFGVDK-GIAKPEIVVYEKAFHGRSIATM 143 Query: 150 NVGGQSKYSDGFGPKITGITHVPYNDLAALKAAV--SDKTCAVVLEPIQGEGGVLPAELS 207 + G K +GFGP + G VP ND+ A+K A + AV E IQGEGG+ + Sbjct: 144 SATGNPKIHNGFGPLVEGFVRVPMNDIEAIKQATEGNPNVVAVFFETIQGEGGINGMRIE 203 Query: 208 YLQGARELCDAHNALLVFDEVQTGMGRSGKLFAYQHYGVTPDILTSAKSLGGGFPIAAML 267 YLQ R+LCD L++ DEVQ GMGR+GK FA+Q G+ PD++ AK LG G PI A++ Sbjct: 204 YLQQLRKLCDERGWLMMIDEVQCGMGRTGKWFAHQWAGIVPDVMPLAKGLGSGVPIGAVV 263 Query: 268 TTEDLAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLNGVNAKHDKFKTRLE-QIG 326 A L G HGTT+GGNPLA I ++ +L+ D + L+ ++G Sbjct: 264 AGPKAANVLQPGNHGTTFGGNPLAMRAGVETIRIMEEDGLLHNAAQVGDHLRAALQRELG 323 Query: 327 EKYGLFTEVRGLGLLLGCVLSDAWKGKAKDIFNAAEREGLMILQAGPDVIRFAPSLVVED 386 G+ E+RG GL+LG L+ + A GL++ VIR P L++ Sbjct: 324 SLPGV-KEIRGQGLMLGIELNK----PCGALIGRAAEAGLLLSVTADSVIRLVPPLILTT 378 Query: 387 ADIDA 391 A+ DA Sbjct: 379 AEADA 383 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 398 Length adjustment: 31 Effective length of query: 375 Effective length of database: 367 Effective search space: 137625 Effective search space used: 137625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory