Align arginine deiminase (EC 3.5.3.6) (characterized)
to candidate Ac3H11_3030 Amidinotransferase family protein
Query= reanno::Phaeo:GFF1616 (309 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3030 Length = 336 Score = 400 bits (1028), Expect = e-116 Identities = 206/311 (66%), Positives = 241/311 (77%), Gaps = 3/311 (0%) Query: 2 SQLQAPGAVVMIRPHHFCSNPETRDDNAFQTLADD-TADVTSAQAQAEFDGAVTALRGAG 60 S +QAP AVVM+RPHHF NPET DN+FQ TA+ T+ A AE A AL+ G Sbjct: 20 SSIQAPSAVVMVRPHHFHPNPETAGDNSFQAHTTGLTAEDTARHAFAEVTAAAAALQATG 79 Query: 61 VSVHVFDDTGTE-TPDSVFPNNWFSTHAGGHVAVYPMYAANRRKERRWDVIELLKRDYRV 119 V VH+FDD G TPD+VFPNNWFSTHAGGHVA+YPMYA +RR+ERR DVIELLK +YRV Sbjct: 80 VRVHLFDDRGERHTPDAVFPNNWFSTHAGGHVAIYPMYARSRRRERRSDVIELLKAEYRV 139 Query: 120 QDVIDYSGLEQDGLALEGTGAMVLDHIGRIAYTVKSNRADPVLLERFCTHFNFEPMVFEA 179 QDVIDYSGLE DG+ LEGTGAMVLDHI RIAYT +SNRADP+ LERFCTHFN+EPM F Sbjct: 140 QDVIDYSGLEADGMFLEGTGAMVLDHIHRIAYTAQSNRADPMALERFCTHFNYEPMAFVT 199 Query: 180 RDAQGRDVYHTNVLMGIGTDYALICLDMITDPTRRAEVAARLEETGRRVIDLTPEQIAGF 239 DA+GR YHTNV++ +GTD+AL D+ITDP RR V ARL ETGR +++L+P QI+ F Sbjct: 200 ADAEGRPCYHTNVMLCVGTDFALGGFDLITDPARRHAVRARLRETGRELVELSPWQISEF 259 Query: 240 AGNALELTG-HSRLLALSSRAAEVLRADQITIIERSATLLPLSIPTIETAGGSVRCMLAA 298 AGNALEL G R+LALS+RAA L Q T+IERSA LLPL++PTIE AGGSVRCMLA Sbjct: 260 AGNALELQGTQGRVLALSARAAASLSPAQRTVIERSAKLLPLAVPTIELAGGSVRCMLAG 319 Query: 299 IHLSPRERTQS 309 IHL+ R+ Q+ Sbjct: 320 IHLARRDIFQA 330 Lambda K H 0.320 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 336 Length adjustment: 28 Effective length of query: 281 Effective length of database: 308 Effective search space: 86548 Effective search space used: 86548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory