Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate Ac3H11_1480 Aldehyde dehydrogenase B (EC 1.2.1.22)
Query= BRENDA::G5DDC2 (506 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1480 Length = 486 Score = 318 bits (816), Expect = 2e-91 Identities = 180/473 (38%), Positives = 259/473 (54%), Gaps = 10/473 (2%) Query: 14 FVDGEWRPPAQGRRLPVVNPTTEAHIGEIPAGTAEDVDAAVAAARAALKRNRGRDWARAP 73 ++DG+W G L V NP A IG IP A A+AAA A W Sbjct: 17 YIDGQWVDADNGATLAVNNPANGALIGTIPNAGAAQTQTAIAAADRAFG-----PWKDRT 71 Query: 74 GAVRAKYLRAIAAKVIERKQELAKLEALDCGKPYDEAAWDMDDVAGCFEYFADQAEALDK 133 RA+ LR +++ +++LA + + GKP EA ++ A E+FA++A + Sbjct: 72 AEDRARILRRWFELMLQHQEDLALIMTSEQGKPLAEARGEIAYAASYIEWFAEEARRI-- 129 Query: 134 RQNSPVSLPMETFKCHLRREPIGVVGLITPWNYPLLMATWKVAPALAAGCAAVLKPSELA 193 + P + + REP+GV ITPWN+P M T KVAPALAAGC ++KP+ Sbjct: 130 -YGEVIPSPWLDKRIVVTREPVGVCAAITPWNFPAAMITRKVAPALAAGCTIIVKPATQT 188 Query: 194 SVTCLELADICKEVGLPPGVLNIVTGLGPDAGAPLSAHPDVDKVAFTGSFETGKKIMAAA 253 ++ L +A++ G+P GV +++TG GA L+A P V K+ FTGS E G+ + A Sbjct: 189 PLSALAMAELAARAGVPAGVFSVITGDARPIGAELTASPVVRKLTFTGSTEIGRVLAAQC 248 Query: 254 APMVKPVTLELGGKSPIVVFDDVDIDKAVEWTLFGCFWTNGQICSATSRLLVHTKIAKEF 313 AP +K ++LELGG +P +VF+D D+D AV + + GQ C +RLLV + F Sbjct: 249 APTLKKMSLELGGNAPFIVFEDADLDAAVAGAMASKYRNTGQTCVCANRLLVQDGVYDAF 308 Query: 314 NEKMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKKFILNAKSEGATILTGGVRPAHLE 373 EK+ +KV LEEG GP++ E K++ + +AK+ GA ++TGG R H Sbjct: 309 AEKLARTVAALKVGHGLEEGVEQGPLIDEASLTKVEALVADAKARGARVVTGGRR--HAL 366 Query: 374 KGFFIEPTIITDITTSMEIWREEVFGPVLCVKEFSTEDEAIELANDTQYGLAGAVISGDR 433 G F EPTI+ DIT M + REE+FGPV + F TE EAI++ANDT++GLA S D Sbjct: 367 GGTFYEPTILADITPDMRMAREEIFGPVAPLFRFHTEAEAIQMANDTEFGLAAYFYSRDV 426 Query: 434 ERCQRLSEEIDAGIIWVNCSQPCFCQAPWGGNKRSGFGRELGEGGIDNYLSVK 486 R R+S + G++ +N AP+GG K+SG GRE GI+ Y+ K Sbjct: 427 GRVWRVSGALQYGMVGINAGVISTAVAPFGGVKQSGMGREGSVHGIEEYVDTK 479 Lambda K H 0.318 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 583 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 486 Length adjustment: 34 Effective length of query: 472 Effective length of database: 452 Effective search space: 213344 Effective search space used: 213344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory