Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate Ac3H11_1486 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase (EC 1.2.1.60)
Query= metacyc::MONOMER-11560 (497 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1486 Length = 485 Score = 345 bits (885), Expect = 2e-99 Identities = 206/464 (44%), Positives = 271/464 (58%), Gaps = 13/464 (2%) Query: 33 SGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAPAKRKAKLIR-FA 91 S E FE ++P LA+VAS A+ + AV A+ F + W+ L PA +AKL+R Sbjct: 14 SREYFETVNPATQEVLAEVASGGAAEVHAAVAAAKDAFPA--WAGL-PAPERAKLVRKLG 70 Query: 92 DLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYDEVAPTPHDQLG 151 DL+ V LAL ET D G+ IG + IP AA ++ AE +V PTP L Sbjct: 71 DLIAAEVPTLALTETKDTGQVIGQTGKALIPRAADNFYYFAEMCTRVDGHTYPTP-THLN 129 Query: 152 LVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLTAIRIAQLAIEAG 211 PVGV I PWN P + + WK+ PALA GN+ VLK SE SPLTA R+ +LA+EAG Sbjct: 130 YTLFHPVGVCALISPWNVPFMTSTWKVAPALAFGNTAVLKMSELSPLTAARLGELALEAG 189 Query: 212 IPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNMKRIWLEAGGK 271 IPAGVLNV+ GYG G+ L H DV + FTGST +++ AG +K+ +E GGK Sbjct: 190 IPAGVLNVVHGYGKDAGEPLCTHPDVRAISFTGSTATGNRIVQAAG---LKKFSMELGGK 246 Query: 272 SPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLPMVVEALKGWKP 331 SP +VFADA DL A +AA I N GE CTAGSR+LV++SI F + Sbjct: 247 SPFVVFADA-DLDRALDAALFMIFSNNGERCTAGSRILVQKSIYADFAEKFAARARRIVV 305 Query: 332 GNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEETG----GTYVEPTI 387 G+PLD +T VG ++ + V SYIE G K+GA LL GG T + G +V PT+ Sbjct: 306 GDPLDEKTIVGPMISQAHLAKVRSYIELGPKEGATLLCGGLGTPDLPAHLQKGNFVLPTV 365 Query: 388 FDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTSDISKAHKTARA 447 F V N M+IAQEEIFGPV +I F+ EA+ +AND YGL++ +WT +I +AH+ A Sbjct: 366 FADVDNRMKIAQEEIFGPVACLIPFEDEAEAIRLANDIQYGLSSYVWTENIGRAHRVAAG 425 Query: 448 VRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELK 491 + AG +VN + D+ PFGG K SG GR+ + E + E K Sbjct: 426 IEAGMCFVNSQNVRDLRQPFGGTKGSGTGREGGTWSYEVFLEPK 469 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 608 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 485 Length adjustment: 34 Effective length of query: 463 Effective length of database: 451 Effective search space: 208813 Effective search space used: 208813 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory