GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Acidovorax sp. GW101-3H11

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate Ac3H11_1480 Aldehyde dehydrogenase B (EC 1.2.1.22)

Query= BRENDA::P51650
         (523 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1480 Aldehyde
           dehydrogenase B (EC 1.2.1.22)
          Length = 486

 Score =  530 bits (1366), Expect = e-155
 Identities = 255/480 (53%), Positives = 360/480 (75%), Gaps = 6/480 (1%)

Query: 46  LLRGDSFVGGRWLPTP--ATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFSSWKEI 103
           LL+   ++ G+W+     AT  V +PA+GA +GT+ + G  + + A+ AA  AF  WK+ 
Sbjct: 11  LLKARCYIDGQWVDADNGATLAVNNPANGALIGTIPNAGAAQTQTAIAAADRAFGPWKDR 70

Query: 104 SVKERSSLLRKWYDLMIQNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARRVY 163
           + ++R+ +LR+W++LM+Q++++LA I+T+E GKPL EA+GEI Y+A ++EWF+EEARR+Y
Sbjct: 71  TAEDRARILRRWFELMLQHQEDLALIMTSEQGKPLAEARGEIAYAASYIEWFAEEARRIY 130

Query: 164 GDIIYTSAKDKRGLVLKQPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPY 223
           G++I +   DKR +V ++PVGV + ITPWNFP+AMITRKV  ALAAGCT++VKPA  TP 
Sbjct: 131 GEVIPSPWLDKRIVVTREPVGVCAAITPWNFPAAMITRKVAPALAAGCTIIVKPATQTPL 190

Query: 224 SALALAQLANQAGIPPGVYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKILLHH 283
           SALA+A+LA +AG+P GV++VI      A+ +G  L   P+V K++FTGST  G++L   
Sbjct: 191 SALAMAELAARAGVPAGVFSVI---TGDARPIGAELTASPVVRKLTFTGSTEIGRVLAAQ 247

Query: 284 AANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDS 343
            A ++K++S+ELGG APFIVF+ A++D AVAGAMASK+RN GQTCVC+NR LVQ G++D+
Sbjct: 248 CAPTLKKMSLELGGNAPFIVFEDADLDAAVAGAMASKYRNTGQTCVCANRLLVQDGVYDA 307

Query: 344 FVTKFAEAMKKSLRVGNGFEEGTTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKRHQS 403
           F  K A  +  +L+VG+G EEG  QGPLI+E ++ KVE  V DA A+GA VVTGG+RH  
Sbjct: 308 FAEKLARTV-AALKVGHGLEEGVEQGPLIDEASLTKVEALVADAKARGARVVTGGRRHAL 366

Query: 404 GGNFFEPTLLSNVTRDMLCITEETFGPVAPVIKFDKEEEAVAIANAADVGLAGYFYSQDP 463
           GG F+EPT+L+++T DM    EE FGPVAP+ +F  E EA+ +AN  + GLA YFYS+D 
Sbjct: 367 GGTFYEPTILADITPDMRMAREEIFGPVAPLFRFHTEAEAIQMANDTEFGLAAYFYSRDV 426

Query: 464 AQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL 523
            ++WRV+  L+ GMVG+N G+IS+   PFGGVKQSG+GREGS +GI+EY++ KY+C GG+
Sbjct: 427 GRVWRVSGALQYGMVGINAGVISTAVAPFGGVKQSGMGREGSVHGIEEYVDTKYLCMGGV 486


Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 654
Number of extensions: 21
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 486
Length adjustment: 34
Effective length of query: 489
Effective length of database: 452
Effective search space:   221028
Effective search space used:   221028
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory