GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupA in Acidovorax sp. GW101-3H11

Align Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate Ac3H11_1109 ABC transporter ATP-binding protein

Query= TCDB::A2RKA7
         (506 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1109 ABC transporter
           ATP-binding protein
          Length = 513

 Score =  337 bits (864), Expect = 6e-97
 Identities = 196/494 (39%), Positives = 288/494 (58%), Gaps = 9/494 (1%)

Query: 10  IDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHVKGKL 69
           + +TKR+   VAN  V+L +  GEIHA+LGENGAGKSTLM I+ G ++P EG V   G+ 
Sbjct: 1   VGITKRYPAVVANSGVSLTVLPGEIHAVLGENGAGKSTLMKIIYGSVKPDEGSVFFNGQA 60

Query: 70  ENIDSPSKAANLGIGMVHQHFMLVDAFTVTENIILGNEVTKGINLDLKTAKKKILELSER 129
             + +P +A  LGI MV QHF L D  TV EN+ LG + +    L L    ++I   +  
Sbjct: 61  VQVRNPQEARALGIAMVFQHFSLFDTLTVAENVWLGLDKS----LTLAEVTQRISAKAAE 116

Query: 130 YGLSVEPDALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITELMQIMKNLI 189
           YGL ++P   +  +SVG+ QRVEI++ L     +LI DEPT+VLTP  + +L  +++ L 
Sbjct: 117 YGLDIDPLRPVHTLSVGEMQRVEIIRALLTNPKVLILDEPTSVLTPQAVEKLFVVLRKLA 176

Query: 190 KEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVGRSVSFITEK 249
            EG SI+ I+HKL EIRA+    TV+R GK        ++TN  L+ LM+G     + E 
Sbjct: 177 SEGCSILYISHKLHEIRALCTACTVLRGGKVTGVCNPSEETNASLSRLMIGAEPPAL-EH 235

Query: 250 AAAQPKDVVLEIKDLNI-KESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQTELVKAITGL 308
            A Q    VL +K L++ +  +  + +  L  +V+AGE+VG+AG+ GNGQ EL+ A++G 
Sbjct: 236 RAVQTGATVLRVKGLSLPRADQFGVDLIDLQFEVKAGEVVGIAGVSGNGQKELLYALSGE 295

Query: 309 T-KVDSGSIKLHNKDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIALQTYYKPP 367
             + +  SI++  ++     P +     +  VPE+R   G V  M +A N+ L    K  
Sbjct: 296 DQRAEPASIQVTGQNAGRMGPGQRRALGLHFVPEERLGRGAVPTMGLAHNLLLTR--KNA 353

Query: 368 MSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREIDRNPDLLIV 427
           +   G++    +  HA ++++ F+V+  G   +A SLSGGN QK I+ REID NP LLIV
Sbjct: 354 VGGSGWIKVGALQKHAEDIIQRFNVKAGGPHSAAKSLSGGNLQKFIVGREIDANPKLLIV 413

Query: 428 SQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQIQGIVSP 487
           SQPT G+DVGA   I   ++  RD G AVLV+S ELDE+  + DR+ V+  G++   V  
Sbjct: 414 SQPTWGVDVGAAAQIRGSILALRDAGCAVLVVSEELDELFEICDRLHVVAKGRLSPSVQR 473

Query: 488 ETTTKQELGILMVG 501
              T + +G  M G
Sbjct: 474 AEATVERIGEWMSG 487


Lambda     K      H
   0.315    0.135    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 614
Number of extensions: 31
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 506
Length of database: 513
Length adjustment: 34
Effective length of query: 472
Effective length of database: 479
Effective search space:   226088
Effective search space used:   226088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory