Align Ribokinase (EC 2.7.1.15) (characterized)
to candidate Ac3H11_1839 Ribokinase (EC 2.7.1.15)
Query= reanno::HerbieS:HSERO_RS11500 (299 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1839 Length = 314 Score = 224 bits (571), Expect = 2e-63 Identities = 135/299 (45%), Positives = 175/299 (58%), Gaps = 8/299 (2%) Query: 2 IVIIGSVNMDLVLRVPRMPLPGETLAGDRFMTIPGGKGANQAVACARLAAPGTRVAMVAC 61 I ++GS+NMDLVL+V P PGET+ D +PGGKG NQAVACAR G +VA+ Sbjct: 9 IAVVGSLNMDLVLQVQHAPGPGETVLADALHLVPGGKGGNQAVACAR---QGAQVALFGR 65 Query: 62 VGDDAFGGQMRQSITACGIDDRYIDEVAGEATGIASIMVDANAQNSIVIAAGANGRLDVE 121 VGDD +G +R + A GID + TG+A+I V+A QN IV+ GANGR ++ Sbjct: 66 VGDDGYGHTLRAGLDADGIDHSGVQTDTATTTGVAAITVEATGQNRIVVVPGANGRFVLD 125 Query: 122 RIERARALIEQASIVLLQLEVPMATVIHSIELAHALGKTVVLNPAPAQALPRALLQKIDY 181 AL + A ++LQ E P+ V+ + E+AHA G VVLNP+P Q LP AL + Sbjct: 126 ATALGAAL-QGAGGLVLQFETPLRQVLAAAEMAHAAGCPVVLNPSPIQPLPEALWPLVHT 184 Query: 182 LILNEIEAAMLAEEQ---SEDIPMLARKLHDLGARNVVVTLGEKGVYGSFADGQQRHLPA 238 L++NE+EAA LA + D A+ L G VVVTLG G + A G + H P Sbjct: 185 LVVNEVEAAALAGQNVTTPADAAQAAQALRAKGPAQVVVTLGAAGAVAADAAGNRYH-PG 243 Query: 239 RKVQAVDTTAAGDTFIGGFIGAIAQGRDQFEAIAYAQAAAALSVTRVGAQTSIPTRDEV 297 V+AVDTTAAGDTF+G A+A+G + AAAL VT+ GAQ SIPTR V Sbjct: 244 LVVRAVDTTAAGDTFLGALAVALARGEPLDAGVREGIRAAALCVTQHGAQPSIPTRAAV 302 Lambda K H 0.320 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 314 Length adjustment: 27 Effective length of query: 272 Effective length of database: 287 Effective search space: 78064 Effective search space used: 78064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_1839 (Ribokinase (EC 2.7.1.15))
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.31357.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-95 306.0 6.2 1.7e-95 305.8 6.2 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 Ribokinase (EC 2.7.1.15) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 Ribokinase (EC 2.7.1.15) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 305.8 6.2 1.7e-95 1.7e-95 1 297 [. 9 303 .. 9 304 .. 0.98 Alignments for each domain: == domain 1 score: 305.8 bits; conditional E-value: 1.7e-95 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDe 62 i+vvGS+n+Dlvl+v++ p pGetv a+ +++++GGKG NQAva+ar ga+v++ g+vG+D lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 9 IAVVGSLNMDLVLQVQHAPGPGETVLADALHLVPGGKGGNQAVACARQGAQVALFGRVGDDG 70 79************************************************************ PP TIGR02152 63 fgeellenlkkegidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaee 124 +g++l+ l ++gid + v++++ t+tGvA+i+v+ +g+N+Ivvv Gan ++ + +a + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 71 YGHTLRAGLDADGIDHSGVQTDTATTTGVAAITVEATGQNRIVVVPGANGRFVLD-ATALGA 131 ***************************************************9865.566789 PP TIGR02152 125 kikesdlvllQlEipletveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEa 186 +++ + ++lQ+E+pl v +a+++a++ag v+lnP P ++ l+e l+ lv+++v Ne Ea lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 132 ALQGAGGLVLQFETPLRQVLAAAEMAHAAGCPVVLNPSPIQP-LPEALWPLVHTLVVNEVEA 192 9***************************************77.99***************** PP TIGR02152 187 eiLtgievedledaekaaekllekgvkaviitlGskGallvskdekklipalkvkavDttaA 248 ++L g++v++ +da +aa++l++kg +v++tlG+ Ga+ +++ ++ p l v+avDttaA lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 193 AALAGQNVTTPADAAQAAQALRAKGPAQVVVTLGAAGAVAADAAGNRYHPGLVVRAVDTTAA 254 ************************************************************** PP TIGR02152 249 GDtFigalavaLaegksledavrfanaaaalsVtrkGaqssiPtkeeve 297 GDtF galavaLa+g+ l++ vr + +aaal Vt++Gaq+siPt++ v+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1839 255 GDTFLGALAVALARGEPLDAGVREGIRAAALCVTQHGAQPSIPTRAAVA 303 *********************************************9885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (314 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory