Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate Ac3H11_493 toluenesulfonate zinc-independent alcohol dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_493 Length = 253 Score = 114 bits (286), Expect = 2e-30 Identities = 87/251 (34%), Positives = 132/251 (52%), Gaps = 17/251 (6%) Query: 15 VLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESA---LAVFRDKYPGTVAT-RADVSDAA 70 ++++G GIGE +A G +V V D++E+ + GT A +ADV+++A Sbjct: 8 IIVTGAGNGIGEGIAKRLAAEGGKVIVNDINEAGGQRVVAEITAAGGTAAFFKADVTNSA 67 Query: 71 QIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVP 130 Q++A+ G LDV+VNNAG + +S+ E+ IN+ + Y A HAVP Sbjct: 68 QVKAMVDEAVRLYGRLDVVVNNAGWTHRNRPMLEVSEEEFDKVYAINMKSIYLSAIHAVP 127 Query: 131 MLKESSHGHLLHIASVAG---RLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALL 187 L+++ G +++IAS AG R G W Y +K A++ KS+A+ELG +IRVN + Sbjct: 128 ALRQAGGGSIINIASTAGLRPRPGLTW---YNGSKGAVIITSKSMAAELGPDNIRVNCI- 183 Query: 188 PGIVEGPRMDGVIRARAEQVGVPEAEMRQ-EYLNKISLKRMVTAEDVAAMALFLCSPAAR 246 P + AE G P + R+ ++L I L R TA DVA AL+L S A Sbjct: 184 -----NPVFNPDTGLAAEFAGGPVDDARRAKFLATIPLGRFSTALDVANAALYLASEEAS 238 Query: 247 NVTGQAISVDG 257 ++G I VDG Sbjct: 239 FISGVCIEVDG 249 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 253 Length adjustment: 24 Effective length of query: 238 Effective length of database: 229 Effective search space: 54502 Effective search space used: 54502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory