Align cytochrome c component of deoxyribose dehydrogenase (characterized)
to candidate Ac3H11_3427 Isoquinoline 1-oxidoreductase beta subunit (EC 1.3.99.16)
Query= reanno::WCS417:GFF2133 (447 letters) >lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3427 Isoquinoline 1-oxidoreductase beta subunit (EC 1.3.99.16) Length = 1243 Score = 242 bits (617), Expect = 6e-68 Identities = 155/435 (35%), Positives = 216/435 (49%), Gaps = 51/435 (11%) Query: 4 RRFARTAGWLALPCLVAAGLLAWYVTREPATPFEQEQAGATFEPALVSRGEYVARLSDCV 63 R A AG +A+ A LL W R P Q + + A + RG +A DC Sbjct: 813 RALALVAGGIAM----GAALLGW---RPSIAPVVQTVGASVYNAATIERGRLLAAAGDCA 865 Query: 64 ACHSLAGKAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSLADFDRAVRHGVAPGGRRL 123 CH+ G P GG M TP G I+ TN+TPD TGIG +S + F RA+R G++ GG+ L Sbjct: 866 VCHTAPGGTPNTGGRAMETPFGKIYTTNLTPDAETGIGQWSFSAFQRAMREGISQGGKHL 925 Query: 124 YPAMPYPSYVKLSDDDIKALYAFFMQGIKPANQPNIP-SDIPWPLNMRWPIALWNGVFAP 182 YPA PY S+ K+SDDD+ ALYA+ M +PA + +P +++ +P ++R +A WN +F Sbjct: 926 YPAFPYTSFAKMSDDDLTALYAYLM--AQPAVRAEVPKTELTFPFSVRPLMAGWNALFHD 983 Query: 183 TATYAAKPDQDALWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDEAGAPFLAGALLDGWY 242 + P + WNRGAY+VQG GHCG+CHTPR N + GA FL+GA++DGW Sbjct: 984 ATPFKPDPTRPPEWNRGAYLVQGVGHCGACHTPR----NALGAELGGAAFLSGAMIDGWE 1039 Query: 243 APSLRQDPNTGLGR----WSEPQIVQFLKTGRN-AHAVVYGSMTEAFNNSTQFMQDDDLA 297 AP+L TGL + W+ + +L+ G + H G M + DDD+ Sbjct: 1040 APAL-----TGLSKAPVPWTADALYGYLRHGHSPQHGSASGPMAPVVRELAH-LPDDDIR 1093 Query: 298 AIARYLKSLP---------GDPQRDGAPWQYQAVA-AVQDAPGAHTYATRCASCHGLDGK 347 A+A YL S DPQ+ QA A A Q + CA+CH DG Sbjct: 1094 AMASYLASFTAAEAATQPVSDPQQRAQTAVAQAAALAPQPGQAQRLFDGACAACHH-DGD 1152 Query: 348 GQPEWMPPLAGATSALAKES-------ASAINITLNGSQRVVASGVPDAYRMPAFREQLS 400 G P L G LA S + + + ++G + A D MP F LS Sbjct: 1153 G-----PKLLGVNVPLALNSNLHSDRPDNLLQVIVHGIREPAAR---DIGFMPGFGHALS 1204 Query: 401 DTEIAEVLSYVRSTW 415 D +I E+ Y+R + Sbjct: 1205 DAQITELAGYMRQRY 1219 Lambda K H 0.318 0.133 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1661 Number of extensions: 95 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 1243 Length adjustment: 40 Effective length of query: 407 Effective length of database: 1203 Effective search space: 489621 Effective search space used: 489621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory