Align Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 (characterized)
to candidate Ac3H11_3427 Isoquinoline 1-oxidoreductase beta subunit (EC 1.3.99.16)
Query= SwissProt::Q47945 (478 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3427 Length = 1243 Score = 220 bits (561), Expect = 2e-61 Identities = 152/428 (35%), Positives = 212/428 (49%), Gaps = 42/428 (9%) Query: 17 GWKLAAAIGLMAVSFGAAHAQDADEALIKRGEYVARLSDCIACHTALHGQPYAGGLEIKS 76 GW+ + A + V +A A I+RG +A DC CHTA G P GG +++ Sbjct: 830 GWRPSIAPVVQTVGASVYNA-----ATIERGRLLAAAGDCAVCHTAPGGTPNTGGRAMET 884 Query: 77 PIGTIYSTNITPDPEHGIGNYTLEDFTKALRKGIRKDGATVYPAMPYPEFARLSDDDIRA 136 P G IY+TN+TPD E GIG ++ F +A+R+GI + G +YPA PY FA++SDDD+ A Sbjct: 885 PFGKIYTTNLTPDAETGIGQWSFSAFQRAMREGISQGGKHLYPAFPYTSFAKMSDDDLTA 944 Query: 137 MYAFFMHGVKPVALQNKAPDISWPLSMRWPLGMWRAMFVPSMTPGVDKSISDPEVARGEY 196 +YA+ M V + ++++P S+R + W A+F TP PE RG Y Sbjct: 945 LYAYLM-AQPAVRAEVPKTELTFPFSVRPLMAGWNALF-HDATPFKPDPTRPPEWNRGAY 1002 Query: 197 LVNGPGHCGECHTPRGFGMQVKAYGTAGGNAYLAGGAPIDNWIAPSLRSNSDTGLGR--- 253 LV G GHCG CHTPR A G G A GA ID W AP+L TGL + Sbjct: 1003 LVQGVGHCGACHTPR------NALGAELGGAAFLSGAMIDGWEAPAL-----TGLSKAPV 1051 Query: 254 -WSEDDIVTFLKSGRI-DHSAVFGGMADVVAYSTQHWSDDDLRATAKYLKSMPAVPEGKN 311 W+ D + +L+ G H + G MA VV H DDD+RA A YL S A Sbjct: 1052 PWTADALYGYLRHGHSPQHGSASGPMAPVVR-ELAHLPDDDIRAMASYLASFTAAEAATQ 1110 Query: 312 LGQDD--------GQTTALLNKGGQGNAGAEVYLHNCAICHMN-DGTGVNRMFPPLAGNP 362 D Q AL + GQ ++ CA CH + DG + + PLA N Sbjct: 1111 PVSDPQQRAQTAVAQAAALAPQPGQAQ---RLFDGACAACHHDGDGPKLLGVNVPLALNS 1167 Query: 363 VVITDDPTSLANVVAFGGILPPTNSAPSAVAMPGFKNHLSDQEMADVVNFMRKGWGNNAP 422 + +D P +L V+ G P +A MPGF + LSD ++ ++ +MR+ + AP Sbjct: 1168 NLHSDRPDNLLQVIVHGIREP---AARDIGFMPGFGHALSDAQITELAGYMRQRY---AP 1221 Query: 423 GTVSASDI 430 G + D+ Sbjct: 1222 GRPAWRDV 1229 Lambda K H 0.317 0.134 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1790 Number of extensions: 121 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 1243 Length adjustment: 41 Effective length of query: 437 Effective length of database: 1202 Effective search space: 525274 Effective search space used: 525274 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory