Align alcohol dehydrogenase (NADP+) (EC 1.1.1.2); alcohol dehydrogenase [NAD(P)+] (EC 1.1.1.71) (characterized)
to candidate Ac3H11_4515 NADH-dependent butanol dehydrogenase A (EC 1.1.1.-)
Query= BRENDA::U6CL97 (387 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4515 Length = 387 Score = 461 bits (1186), Expect = e-134 Identities = 238/387 (61%), Positives = 284/387 (73%), Gaps = 2/387 (0%) Query: 1 MLNFTLHTPTKILFGEGQIAELGKEIPADARILITYGGGSVKHNGVLDQVYRALEGRNVR 60 MLNF H PT I FG+G+IA+L K +PA A++LI GG S + G L +V AL R Sbjct: 1 MLNFDFHNPTHIAFGQGRIADLAKLVPAAAKVLILVGGASAEKTGTLAEVRAALGERPHA 60 Query: 61 EFSGIEPNPTYETLMKAVEVVRAEKIDFLLAVGGGSVVDGTKFIAAAADYQAAQDPWHIL 120 FSGIEPNP++ET MKAV +R DFLLAVGGGSV+D KFIAAA ++ DPW IL Sbjct: 61 TFSGIEPNPSFETSMKAVAQIREGGFDFLLAVGGGSVIDAVKFIAAAVRFEG-DDPWAIL 119 Query: 121 QTGGAEIDRGVALAAVLTLPATGSESNNGAVITRKSTNDKLAFRSPHTQPLFAVLDPVVT 180 + G I + AVLTLPATGSE NNG VIT ++ KLAF S HT P+F+VLDP T Sbjct: 120 EKHGRNIQDAMPFGAVLTLPATGSEMNNGGVITHRAKGAKLAFGSHHTYPVFSVLDPTKT 179 Query: 181 YTLPARQIANGVVDAFVHTVEQYLTYSVDAKVQDRFAEGLLLTLVEEGPRALAEPEN-YK 239 YTLP +Q+ANGVVDAFVHTVEQYLTY V+A VQDRFAEG+L TL+E GPR L E Y Sbjct: 180 YTLPPQQLANGVVDAFVHTVEQYLTYPVNAPVQDRFAEGILQTLIEIGPRLLTAQEPVYD 239 Query: 240 VRANVMWSATMALNGLIGAGVPQDWSTHMLGHELTALHGLDHAQTLAIVLPAMLAARKSQ 299 RAN+MW+ATMALNGLIGAGVPQDW+THM+GHELTALHG+DHA+TLAIVLPA+L R+ Sbjct: 240 DRANLMWAATMALNGLIGAGVPQDWATHMIGHELTALHGIDHARTLAIVLPALLNERRVA 299 Query: 300 KRDKLLQYAERVWNLRDGSEDQRIDGAIAATRDFFEKMGVPTRLSDYQLDGSSIPTLVAK 359 KR KLLQY ERVW + G++D+RI AI TRDFFE MG+ TRLS Y L G ++ +VA+ Sbjct: 300 KRAKLLQYGERVWGITTGTDDERITAAIERTRDFFESMGIATRLSGYGLGGDTVNAVVAQ 359 Query: 360 LSEHGLTALGEHRDITLEESQKIYEAA 386 L HG+ LGE R+IT S++I EAA Sbjct: 360 LEAHGMVTLGEQREITPAVSRRILEAA 386 Lambda K H 0.317 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 387 Length adjustment: 30 Effective length of query: 357 Effective length of database: 357 Effective search space: 127449 Effective search space used: 127449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory