Align 1-phosphofructokinase; EC 2.7.1.56; Fructose 1-phosphate kinase (uncharacterized)
to candidate Ac3H11_779 Tagatose-6-phosphate kinase (EC 2.7.1.144) / 1-phosphofructokinase (EC 2.7.1.56)
Query= curated2:P23354 (318 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_779 Length = 318 Score = 134 bits (338), Expect = 2e-36 Identities = 99/269 (36%), Positives = 133/269 (49%), Gaps = 10/269 (3%) Query: 6 ITVTLNPAIDQTIQLDRLQPGAVHRASSVRNDAGGKGINVAACLADWGSQVAALGVLGVG 65 IT+TLNPA+D ++ P R V+ AGG GINVA L G+ V A + G Sbjct: 5 ITLTLNPALDLATTTAQVAPTHKLRCGPVQRFAGGGGINVARVLHRLGADVLAWALTGGA 64 Query: 66 NAGVFEALFRERGITDHCHRVAGDTRTNLKLVEAQVNETTDINLPGLQLGQAHLQGVADH 125 + L + G+ +AGDTR N +VE + LPG L A Q D Sbjct: 65 AGAQVQQLLADEGVPTALQAIAGDTRENFSVVETITGQEFRFVLPGPTLQAAEWQACLDA 124 Query: 126 LAPLLRAGLPVVLSGSLPAGLPEDSWAQLQAQASAAGARVLLDTSGAPLVAALAAAPVAM 185 LA L ++ SGSLP G P+D +A+L S G R+++DTSG PL AAL A VA+ Sbjct: 125 LAALPTPPRWLIASGSLPPGTPDDFYARLARALSGRGVRMVVDTSGPPLAAALQAG-VAL 183 Query: 186 PYAVKPNRHELEAWTGHPLGDHAALTAAAHALIARG-IQLVVISMGTEGALFVQRDQQLI 244 VKP+ EL PL A AAA +L+ G + V +S+G +GA+ R + Sbjct: 184 ---VKPSLRELRELVQQPLEQAADWCAAAQSLVHSGAAETVALSLGEQGAVLATRTG--V 238 Query: 245 ARPPRL---AQGSSVGAGDAMVAGLAAAL 270 + P L A + GAGD +A L AL Sbjct: 239 WQAPALNMPATTGTTGAGDCFLAALVWAL 267 Lambda K H 0.318 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 318 Length adjustment: 27 Effective length of query: 291 Effective length of database: 291 Effective search space: 84681 Effective search space used: 84681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory