Align Fructose import permease protein FruF (characterized)
to candidate Ac3H11_606 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)
Query= SwissProt::Q8G846 (356 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_606 Length = 337 Score = 220 bits (560), Expect = 5e-62 Identities = 122/325 (37%), Positives = 193/325 (59%), Gaps = 13/325 (4%) Query: 16 LLSSNLTWSIVAFILLVIICTIFQHDFLALSWNSNTGGLAGPLITMLQESARYLMIATGM 75 LL L W ++ LL+++ T+F FL + W G L G LI +L +A ++++ GM Sbjct: 1 LLRHRLAWPLITLALLLVVNTVFNSSFLHIEWRD--GHLYGSLIDILNRAAPLVLVSLGM 58 Query: 76 TLVISTAGIDLSVGSVMAVAGAAAMQTLSNGMN-------VWLSILIALAVGLAIGCVNG 128 TLVI+T GID+SVG+ +A+A A A + ++ + ++IL A+ V L G NG Sbjct: 59 TLVIATRGIDISVGATVAIAAAVAAWMIGGSVSGTESRFPLPVAILGAIGVALLCGLWNG 118 Query: 129 ALVSFLGLQPFITTLIMMLAGRGMAKVITSGENTDASAVAGNEPLKWFANGFILGIPANF 188 LV+ +G+QP I TLI+M+AGRG+A++IT G+ P + G++ G+P + Sbjct: 119 VLVAKVGMQPIIATLILMVAGRGIAQLITDGQIITIYYT----PYFFLGGGYLAGLPFSV 174 Query: 189 VIAVIIVILVGLLCRKTAMGMMIEAVGINQEASRMTGIKPKKILFLVYAISGFLAAIAGL 248 + + + + L +TA+G+ I+AVGIN A+R+ G++ +++ Y G A IAGL Sbjct: 175 FVVAAVFVALYLAITRTALGLFIQAVGINPTAARVAGVQAGRLIVAAYVFCGVCAGIAGL 234 Query: 249 FATASVMRVDVVKTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITL 308 +++V D GQ LE+ AILAV +GGT+L GG+FSL GS +GA+II + I +L Sbjct: 235 LISSNVKSADGNNAGQLLELDAILAVTLGGTALTGGRFSLVGSVIGALIIQTLTYAIYSL 294 Query: 309 GVNAEATPAFFAVVVIVICVMQAPK 333 GV E AVVV ++ ++Q+P+ Sbjct: 295 GVPPEINLVVKAVVVFIVMLLQSPE 319 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 337 Length adjustment: 29 Effective length of query: 327 Effective length of database: 308 Effective search space: 100716 Effective search space used: 100716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory