Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate Ac3H11_2774 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2774 Length = 276 Score = 131 bits (329), Expect = 2e-35 Identities = 91/259 (35%), Positives = 135/259 (52%), Gaps = 21/259 (8%) Query: 56 RLQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQALAAE-------SDAITT 108 +L GK ++T AGAG+G E A + AR GA V DI+ Q++AAE + AI T Sbjct: 5 KLDGKVAIVTGAGAGLGAECARSLARHGARVAVVDINLEGAQSVAAEIKAGGGKALAIQT 64 Query: 109 QLLDVTDAAAITALVAAH-GPFDVLFNCAGYVHQG------SILDCDEPAWRRSFSINVD 161 L AA+ + V H G DVL N A + + + D AW R+ ++N Sbjct: 65 DLTSEEGVAAMVSAVLDHFGRIDVLHNNAAALDPAQRAGDRDVCNVDLSAWDRAMNVNAR 124 Query: 162 AMYYTCKAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVA 221 CK +P ML+ G GSII +S + G Y +KAA++ L++++AA Y Sbjct: 125 GAMLCCKHAIPHMLKVGGGSIIFATS-GFGLLGDATLTAYAASKAALMALARSVAAQYGK 183 Query: 222 QGVRCNAICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLAS 281 +G+R NAI G + L + Q G Q + + D+ +LG P++IA +V +LAS Sbjct: 184 EGIRSNAIMIGFV----LNEHAQK--GVPQEIKQILLDQHLTPQLGSPKQIADVVSFLAS 237 Query: 282 DESSFTTGQTHIIDGGWSN 300 DESSF TG +DGG+++ Sbjct: 238 DESSFITGAVIPVDGGFTS 256 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 276 Length adjustment: 26 Effective length of query: 274 Effective length of database: 250 Effective search space: 68500 Effective search space used: 68500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory