Align Fucose mutarotase; EC 5.1.3.29 (characterized)
to candidate Ac3H11_3038 L-fucose mutarotase
Query= SwissProt::A2VDF0 (154 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3038 Length = 150 Score = 107 bits (267), Expect = 8e-29 Identities = 64/146 (43%), Positives = 89/146 (60%), Gaps = 4/146 (2%) Query: 4 LKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVL 63 LK + LL+P+LL LA MGH D IVLAD NF A S+ P+ +R G+G+ + ++AV Sbjct: 2 LKNIDPLLTPDLLKVLAEMGHDDAIVLADANFTAMSLGAGKPV-LRLPGIGMARAVQAVA 60 Query: 64 KLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAK-IERFEFYER 122 +LPL V P A M++ E ++ + E +L R G A A+ +ERF FYER Sbjct: 61 SVLPLAQDVPHPVAYMQV--GGTEVPYRSALQRETMDVLAREGVASAQAEGVERFAFYER 118 Query: 123 AKKAFAVVATGETALYGNLILRKGVL 148 KKA+A+V TGE +GN +LRKGV+ Sbjct: 119 VKKAYAIVVTGERQPWGNFLLRKGVI 144 Lambda K H 0.322 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 71 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 154 Length of database: 150 Length adjustment: 17 Effective length of query: 137 Effective length of database: 133 Effective search space: 18221 Effective search space used: 18221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory