Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate Ac3H11_163 TRAP-type C4-dicarboxylate transport system, large permease component
Query= SwissProt::Q9HU16 (427 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_163 Length = 425 Score = 349 bits (895), Expect = e-100 Identities = 176/411 (42%), Positives = 270/411 (65%), Gaps = 1/411 (0%) Query: 10 LFLLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIKLFETSEHYTLLAIPFFLLSGAFM 69 + L + + +AVS+GL+ L I + + + S+ ++F + + L AIPFF+L+G M Sbjct: 9 MVLCFALTISVAVSIGLASILGIQASNANMLISVK-EMFASINKFPLAAIPFFILAGNLM 67 Query: 70 TTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSIAIAGMVRS 129 TGG++RRL++FA + VG ++GGL + VL CM+FAA+SGSS AT A+G+I I +++ Sbjct: 68 ETGGISRRLVEFAKSIVGGVQGGLPMTCVLTCMIFAAVSGSSVATTFAIGAILIPALIKH 127 Query: 130 GYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGVVPGLLLGLILMVVI 189 GYP ++ A + + LG++IPPSI M++Y + E S+G+LFIAG PGLL+ LM+ + Sbjct: 128 GYPTSYAAALQATSAELGVIIPPSIPMILYGVSAEVSIGELFIAGFGPGLLISGALMLFV 187 Query: 190 YIVARVKKLPAMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPTEAAAVAAVYSA 249 + + K + + +A W LL+ VIILGGIY G FTPTEA+AVA Y+ Sbjct: 188 WAYCKYKGWGKNDGDGRMPFGKATLQAGWALLMPVIILGGIYGGVFTPTEASAVAVFYAL 247 Query: 250 FVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQSIASWVTELG 309 V + +YR+++L + +L +S + ++MFIIANA LFA ++T +P +I W+ + Sbjct: 248 LVGVVIYREIKLRDLYAILRKSAISSAVIMFIIANAGLFAFLITRAGVPDAIGRWLEAVL 307 Query: 310 LSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGIIMVVNMEIGL 369 SP +FLL VN L + G F+E SA I++LAPI P+AM GIDP+H G+IMVVN+ +G+ Sbjct: 308 QSPALFLLGVNAALFVIGMFIETSAAIIVLAPILAPVAMHFGIDPVHFGLIMVVNLALGM 367 Query: 370 ITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIPAVSLAL 420 ITPP G+NLF V + L I+ LP++ ++LV L+++TY+P++SLAL Sbjct: 368 ITPPFGVNLFAACTVAKISLDRIIKHLLPFVCVILVCLLVITYVPSISLAL 418 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 490 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 425 Length adjustment: 32 Effective length of query: 395 Effective length of database: 393 Effective search space: 155235 Effective search space used: 155235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory