Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate Ac3H11_1002 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1002 Length = 356 Score = 217 bits (553), Expect = 4e-61 Identities = 121/300 (40%), Positives = 180/300 (60%), Gaps = 11/300 (3%) Query: 2 ATLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGA 61 A +E+ + K Y G P + I L+I G + L+GPSGCGKST + IAG E+++ G Sbjct: 11 AAIEIVALTKRYASGKP-AVDAINLRIASGSYCCLLGPSGCGKSTTLRMIAGHESVTSGD 69 Query: 62 ILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSK 121 IL+++ +I+ + R AM+FQS+AL+P +S DN+AF LK++ +P AE + + + Sbjct: 70 ILLENRNITDLPAAARGTAMMFQSFALFPHLSALDNVAFSLKMKGVPKAERQAKARDLLE 129 Query: 122 LLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLM 181 + + HL RKP +LSGGQQQRVA+ RAL +P++ L DEPLS LD LR++MR E++ Sbjct: 130 RVALGHLAERKPAELSGGQQQRVALARALITQPRVLLLDEPLSALDPFLRIQMRAELRRW 189 Query: 182 HQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPPM 241 + L T ++VTH Q EAM L D + VM G+I+Q G+P ++YN PA+ FVA F+G + Sbjct: 190 QKELGLTFIHVTHSQEEAMALADTMVVMNHGVIEQVGSPHEVYNRPASEFVARFMGGHNV 249 Query: 242 NFIPLRLQRKDGRLLALLDSGQARCELPLGMQ-------DAGLEDREVILGIRPEQIILA 294 P + K G L A ELP G Q D + V+LG++ + + L+ Sbjct: 250 IDTP---EGKVGVRTDHLQIAPASAELPWGAQRMLAVVTDVEYQGTYVLLGLQKQGVALS 306 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 356 Length adjustment: 30 Effective length of query: 356 Effective length of database: 326 Effective search space: 116056 Effective search space used: 116056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory