Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate Ac3H11_1540 UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)
Query= SwissProt::Q9ZDJ5 (341 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1540 Length = 290 Score = 192 bits (488), Expect = 9e-54 Identities = 109/239 (45%), Positives = 149/239 (62%), Gaps = 16/239 (6%) Query: 58 LKFYIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAIN 117 L+++IGDVR+ + A+ G+D V HAAALKQVP E+ P E I TNVLGA+N++ A ++ Sbjct: 13 LRYFIGDVRDEARLRRALEGIDIVVHAAALKQVPAAEYNPFECIKTNVLGAQNLIEACLS 72 Query: 118 NKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGS 177 N V +V+ LSTDKA P+N G +K +KL IA ++ + V RYGNVM SRGS Sbjct: 73 NGVQRVVALSTDKAAAPVNLYGATKLCSDKLFIAANNIKGNRDIRFSVVRYGNVMGSRGS 132 Query: 178 VIPLFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIEV 237 VIP F+ + K G L IT+P MTRF +SL + VD+VL++ EH G++ V K P+ I Sbjct: 133 VIPFFLEKRKSG-ALPITDPRMTRFNISLQEGVDMVLWSIEHAWGGEVLVPKIPSYRITD 191 Query: 238 LAKAL-----QEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGGYYRI-PMDGR 290 +A A+ QEI IG R GEK +E +++S D A DLG YY I P+ G+ Sbjct: 192 VATAVAPNCRQEI---------IGIRPGEKIHEEMITSSDAASTVDLGSYYAILPLAGQ 241 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 290 Length adjustment: 27 Effective length of query: 314 Effective length of database: 263 Effective search space: 82582 Effective search space used: 82582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory