Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate Ac3H11_1841 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1841 Length = 892 Score = 137 bits (344), Expect = 1e-36 Identities = 90/251 (35%), Positives = 135/251 (53%), Gaps = 5/251 (1%) Query: 29 FASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKVIGDFGLSPL 88 F S I + L ++AVGMTFV++ GIDLSVGSV+A A I +G + Sbjct: 610 FWSAETFITIANEIPALAVMAVGMTFVLIIAGIDLSVGSVMALAAATSAAAILQWGWTVP 669 Query: 89 LAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPIYDT 148 A L L G G G + A ++P+FI++L + +RG +Y+V++ + D Sbjct: 670 AAAALALATGLVCGTITGAISVAWRLPSFIVSLGMLEAVRGSAYVVTDSRTQY---VGDA 726 Query: 149 LSSLAWKIPGGGRLSAMGLLMLAVVVIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRS 208 +S L+ GG +S LL + +VV+ + RT FG V IG N + L G+ R Sbjct: 727 ISWLSAPFFGG--ISFAFLLAVVLVVVAQLVLSRTVFGRCVVGIGTNEEAMRLAGVDPRP 784 Query: 209 TTIRIYMLSTGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGT 268 + ++ ++ LA LAG++ S +A AG G+EL IA+VVIGGT L GG G+V+ T Sbjct: 785 IRVIVFAMTGLLAGLAGLMQSARLEAADPNAGTGMELQVIAAVVIGGTSLMGGRGSVVNT 844 Query: 269 LFGVAIQGLIQ 279 FGV I +++ Sbjct: 845 AFGVLIIAVLE 855 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 892 Length adjustment: 35 Effective length of query: 296 Effective length of database: 857 Effective search space: 253672 Effective search space used: 253672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory