GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ytfR in Acidovorax sp. GW101-3H11

Align galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized)
to candidate Ac3H11_2881 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

Query= ecocyc::YTFR-MONOMER
         (500 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2881 Ribose ABC
           transport system, ATP-binding protein RbsA (TC
           3.A.1.2.1)
          Length = 496

 Score =  306 bits (785), Expect = 8e-88
 Identities = 181/465 (38%), Positives = 270/465 (58%), Gaps = 7/465 (1%)

Query: 15  LSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGTIWLEGQAIS 74
           ++K F  V+ L  V F+L+ G +  LLGENGAGKSTL+K L G      G + ++G   +
Sbjct: 10  VTKEFGPVRVLHGVGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGEVVVDGAVRA 69

Query: 75  PKNTAHAQQL-GIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRKEMEKRATELMASY 133
           P   + A +  GI  ++QE NL  ++++A N+F+G E KR   L  K M ++  E +A  
Sbjct: 70  PGGGSRAAEAQGIVLIHQEFNLADDLTIAQNIFLGHEIKRGLFLDDKAMREKTREALAKV 129

Query: 134 GFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELLFDLMRQLRD 193
           G  LD    + +  VA +Q+V I RA+  +A++LI+DEPTA+L   E E LF LM  L+ 
Sbjct: 130 GLPLDPDTRVRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERLFALMAGLKA 189

Query: 194 RGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKMMLGRELDTHALQR 253
            GV++I+++H LD+V + +D + V+R+G  V    T  + + ++  +M+GREL       
Sbjct: 190 AGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVTRRQMANLMVGREL-ADLFPP 248

Query: 254 AGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPAD 313
                    P    +     G     D EVR GEI+G AGL+G+GRTE  E + G++P  
Sbjct: 249 KLPAPQDGAPAITVRGLTVPGWAEGVDFEVRRGEILGFAGLVGAGRTELFEGLLGLRPRT 308

Query: 314 SGTALIKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENI-ILALQA-QRGWLR 371
           +GT  I G+P  L+SP  A+  G+ +  EDRK  G+     +R N+ ++AL+   + WL 
Sbjct: 309 AGTVEIAGQPVQLKSPRDAARHGLTYLSEDRKGKGLHVHFGLRPNLTLMALERYAKPWLD 368

Query: 372 PISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTRPQFLILDEPTR 431
           P +   +Q      +++ GIRT S E     LSGGNQQK+ L++ L   P  ++LDEPTR
Sbjct: 369 PAA---EQAALREAVQEFGIRTGSLEVRASSLSGGNQQKLALAKVLHPGPSVVVLDEPTR 425

Query: 432 GIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMR 476
           G+DVGA  EI  L++ L   GLA++VISSEL EL+G   RV +MR
Sbjct: 426 GVDVGAKREIYHLVQRLAEQGLAVIVISSELMELIGLCHRVAVMR 470



 Score = 74.3 bits (181), Expect = 9e-18
 Identities = 58/230 (25%), Positives = 112/230 (48%), Gaps = 19/230 (8%)

Query: 26  DNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGTIWLEGQAISPKNTAHAQQLG 85
           + VDF +RRGEI+   G  GAG++ L + L G+     GT+ + GQ +  K+   A + G
Sbjct: 272 EGVDFEVRRGEILGFAGLVGAGRTELFEGLLGLRPRTAGTVEIAGQPVQLKSPRDAARHG 331

Query: 86  IGTVYQE---------VNLLPNMSVADNLFIGREPKRFGLLRRKEMEKRATELMASYGF- 135
           +  + ++           L PN+++   + + R  K +  L     +    E +  +G  
Sbjct: 332 LTYLSEDRKGKGLHVHFGLRPNLTL---MALERYAKPW--LDPAAEQAALREAVQEFGIR 386

Query: 136 --SLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELLFDLMRQLRD 193
             SL+VR   +  S   QQ +A+ + +     V++LDEPT  +D      ++ L+++L +
Sbjct: 387 TGSLEVRA--SSLSGGNQQKLALAKVLHPGPSVVVLDEPTRGVDVGAKREIYHLVQRLAE 444

Query: 194 RGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKMMLG 243
           +G+++I ++  L ++  +  R+ V+R G      +   L + EL+    G
Sbjct: 445 QGLAVIVISSELMELIGLCHRVAVMRAGRLQTTLQEPHLTEEELIAHATG 494



 Score = 65.5 bits (158), Expect = 4e-15
 Identities = 55/228 (24%), Positives = 105/228 (46%), Gaps = 15/228 (6%)

Query: 268 KNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTALIKGKPQNLR 327
           K +G    +      ++PG + GL G  G+G++   +++ G +   +G  ++ G    +R
Sbjct: 12  KEFGPVRVLHGVGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGEVVVDGA---VR 68

Query: 328 SP----HQASVLGIGFCPEDRKTDGIIAAASVRENIILALQAQRGWLRPISRKEQQEIAE 383
           +P      A   GI    ++     +    ++ +NI L  + +RG    +  K  +E   
Sbjct: 69  APGGGSRAAEAQGIVLIHQEFN---LADDLTIAQNIFLGHEIKRGLF--LDDKAMREKTR 123

Query: 384 RFIRQLGIRT-PSTEQPIEFLSGGNQQKVLLSRWLLTRPQFLILDEPTRGIDVGAHAEII 442
             + ++G+   P T   +  L    +Q V ++R L    + LI+DEPT  +  G    + 
Sbjct: 124 EALAKVGLPLDPDTR--VRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERLF 181

Query: 443 RLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQVAEIPLAELS 490
            L+  L A G+ ++ IS +L+E+    D V++MRD   VA    A ++
Sbjct: 182 ALMAGLKAAGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVT 229


Lambda     K      H
   0.321    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 580
Number of extensions: 37
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 500
Length of database: 496
Length adjustment: 34
Effective length of query: 466
Effective length of database: 462
Effective search space:   215292
Effective search space used:   215292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory