Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate Ac3H11_1841 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1841 Length = 892 Score = 154 bits (390), Expect = 6e-42 Identities = 106/327 (32%), Positives = 172/327 (52%), Gaps = 25/327 (7%) Query: 11 TPKRRFRWPTGMPQLVALLLVLL----VDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPV 66 TP W + + + LL VL + S ++ +FW + I I N + Sbjct: 575 TPSSASVWRSQLGTYLGLLAVLAGMVALFSSLSEYFWSAE--------TFITIANEIPAL 626 Query: 67 ALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVA-GFSLPIVLLSALGTGILAGLWN 125 A++A+GMT V+ GIDLSVG+VMA+A AT+AA + G+++P AL TG++ G Sbjct: 627 AVMAVGMTFVLIIAGIDLSVGSVMALAAATSAAAILQWGWTVPAAAALALATGLVCGTIT 686 Query: 126 GILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSW-----FGSGSLLFLPT 180 G + ++ F+ +L ++ A RG A ++T + + +SW FG S FL Sbjct: 687 GAISVAWRLPSFIVSLGMLEAVRGSAYVVTDSR-TQYVGDAISWLSAPFFGGISFAFLLA 745 Query: 181 PVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIA 240 V++ V L+L +T G + +G N A + AGV+ R I ++ + ++GL A +A Sbjct: 746 VVLVVVAQLVL-----SRTVFGRCVVGIGTNEEAMRLAGVDPRPIRVIVFAMTGLLAGLA 800 Query: 241 GIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGIL 300 G++ +A + AD N AG +EL I AVVIGG SLMGGR +++ + G LII + G+ Sbjct: 801 GLMQSARLEAADPN-AGTGMELQVIAAVVIGGTSLMGGRGSVVNTAFGVLIIAVLEAGLA 859 Query: 301 LSGFPPEMNQVVKAVVVLCVLIVQSQR 327 G +++ V++ +IV + R Sbjct: 860 QVGASEPSKRIITGFVIVAAVIVDTLR 886 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 639 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 892 Length adjustment: 36 Effective length of query: 305 Effective length of database: 856 Effective search space: 261080 Effective search space used: 261080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory