Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate Ac3H11_606 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_606 Length = 337 Score = 301 bits (771), Expect = 2e-86 Identities = 163/333 (48%), Positives = 223/333 (66%), Gaps = 12/333 (3%) Query: 13 KRRFRWPTGMPQLVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIG 72 + R WP L+ L L+L+V+++ F + +DG L+GS IDILNRAAP+ L+++G Sbjct: 3 RHRLAWP-----LITLALLLVVNTVFNSSFLHIEWRDGHLYGSLIDILNRAAPLVLVSLG 57 Query: 73 MTLVIATGGIDLSVGAVMAIAGATTAAM-------TVAGFSLPIVLLSALGTGILAGLWN 125 MTLVIAT GID+SVGA +AIA A A M T + F LP+ +L A+G +L GLWN Sbjct: 58 MTLVIATRGIDISVGATVAIAAAVAAWMIGGSVSGTESRFPLPVAILGAIGVALLCGLWN 117 Query: 126 GILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVIIA 185 G+LVA + +QP +ATLILMVAGRG+AQLIT GQI+T + G G L LP V + Sbjct: 118 GVLVAKVGMQPIIATLILMVAGRGIAQLITDGQIITIYYTPYFFLGGGYLAGLPFSVFVV 177 Query: 186 VLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVA 245 + +L +TALG+FI+AVGIN AA+ AGV +++ YV G+CA IAG++++ Sbjct: 178 AAVFVALYLAITRTALGLFIQAVGINPTAARVAGVQAGRLIVAAYVFCGVCAGIAGLLIS 237 Query: 246 ADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFP 305 ++++ AD NNAG LELDAILAV +GG +L GGRF+L+ SV+GALIIQ + I G P Sbjct: 238 SNVKSADGNNAGQLLELDAILAVTLGGTALTGGRFSLVGSVIGALIIQTLTYAIYSLGVP 297 Query: 306 PEMNQVVKAVVVLCVLIVQSQRFISLIKGVRSR 338 PE+N VVKAVVV V+++QS F + + + R Sbjct: 298 PEINLVVKAVVVFIVMLLQSPEFRAQVGALARR 330 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 337 Length adjustment: 28 Effective length of query: 313 Effective length of database: 309 Effective search space: 96717 Effective search space used: 96717 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory