Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate Ac3H11_615 L-arabinolactonase (EC 3.1.1.15)
Query= uniprot:Q888H2 (294 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_615 Length = 316 Score = 153 bits (387), Expect = 4e-42 Identities = 105/295 (35%), Positives = 143/295 (48%), Gaps = 12/295 (4%) Query: 6 IVDAQNATGESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAADSRG- 64 ++ NA GE +WSVREQA+YWVDI ELHRWD + + W + ++ IA + Sbjct: 28 VIALGNALGEGVLWSVREQAVYWVDILGRELHRWDPATGAHQRWTFDEEISAIAERAHAP 87 Query: 65 GWIAGMENGLYHLQPCDDGSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTMLMDMAA 124 G+I + G P D + L E + G RFNDG+CD QGRFWAG+ MD A Sbjct: 88 GFIVTLRRGFALFDPATD--MAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGS--MDFAC 143 Query: 125 GAVVGALYRYSAGQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFDYDTDS 184 A GALYRY + V NG +S G+ + + + +D D + Sbjct: 144 EAPTGALYRYDSDGSCTRHD-DGFAVTNGPTWSGTGQGAAMFFNATIEGNTYRYDSDLAT 202 Query: 185 GTPHDRRLFVDMNNYLGRPDGAAIDADGCYWIC--GNDAGLVHRFTPNGKLDRSLVVPVK 242 GT ++ L+ G PDG DA G WI G H +L R + +PV Sbjct: 203 GTVSNKTLWKHWLPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTAAELGR-VRLPVS 261 Query: 243 KPAMCAFGGPNLDTLFVTSIRPG---GDLSDQPLAGGVFALRPGVKGLEEPVFQG 294 + CAFGG +L TLF++S R G L+ +PLAG +FA+ GL F G Sbjct: 262 QVTTCAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSLGLPAHPFGG 316 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 316 Length adjustment: 27 Effective length of query: 267 Effective length of database: 289 Effective search space: 77163 Effective search space used: 77163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory