Align TRAP dicarboxylate transport system, small permease component (DctQ-like) (characterized, see rationale)
to candidate Ac3H11_1229 TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter
Query= uniprot:G8AR26 (179 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1229 Length = 195 Score = 130 bits (326), Expect = 2e-35 Identities = 62/130 (47%), Positives = 86/130 (66%) Query: 3 RLVEALEMVTEWIMALMLAVMVALVFGNVVLRYGFNSGIVAAEELARLMFVWLVFLGATL 62 R++ V + + L LAVMV LVFGNVVLRY NSGI +EEL+R +FVWL F+GA + Sbjct: 7 RVLRGYTRVLDALSGLCLAVMVVLVFGNVVLRYTLNSGITVSEELSRWLFVWLTFMGAVV 66 Query: 63 ALRRHQHLGLDILQARLPARVRRACAVISHLLMIYALWLFIQGSWFQLLIGMETRSTVLS 122 ALR H HLG D L +RLPA ++AC +++ + M+Y WL + GSW Q+LI +T + V Sbjct: 67 ALREHGHLGTDALVSRLPALGKKACLLLAQIAMLYVSWLLLSGSWAQMLINWDTEAPVTG 126 Query: 123 FPMAFYAAAG 132 + + A+G Sbjct: 127 ASVGIFYASG 136 Lambda K H 0.331 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 96 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 179 Length of database: 195 Length adjustment: 20 Effective length of query: 159 Effective length of database: 175 Effective search space: 27825 Effective search space used: 27825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory