Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate Ac3H11_2554 Amino acid ABC transporter, permease protein
Query= reanno::pseudo5_N2C3_1:AO356_00470 (220 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2554 Length = 222 Score = 130 bits (327), Expect = 2e-35 Identities = 73/208 (35%), Positives = 130/208 (62%), Gaps = 1/208 (0%) Query: 11 LWVARDTLWAGFLTSVQCSLLAIVLGTLIGLVAGLV-LTYGRTWMRAPFRFYVDLIRGTP 69 +W L AG L +V+ + +++LG ++GL+ G+ L R + A YV IRGTP Sbjct: 8 VWAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTP 67 Query: 70 VFVLVLACFYMAPALGWQIGAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASQAIG 129 + V + F+ P G + AF GV+GL ++ G++V+E+VRGA+Q++ +GQMEA+++IG Sbjct: 68 LLVQLFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIG 127 Query: 130 LTFYQSLGYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTL 189 ++ ++ V+LPQA+ +++P N ++K S L+S++ + +L+ Q+II+ ++ +L Sbjct: 128 MSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSL 187 Query: 190 EFYLFAGFLFFIINYAIELLGRHIEKRV 217 E YL ++FI+ A L+ R IE R+ Sbjct: 188 EVYLAIAVVYFILTGATTLVLRRIELRL 215 Lambda K H 0.330 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 222 Length adjustment: 22 Effective length of query: 198 Effective length of database: 200 Effective search space: 39600 Effective search space used: 39600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory