Align D-glucosaminate dehydratase (EC 4.3.1.9) (characterized)
to candidate Ac3H11_693 D-serine deaminase (EC 4.3.1.18)
Query= reanno::pseudo5_N2C3_1:AO356_00450 (405 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_693 Length = 428 Score = 264 bits (674), Expect = 4e-75 Identities = 160/401 (39%), Positives = 222/401 (55%), Gaps = 22/401 (5%) Query: 21 LLKDVSLPALVLHRAALEHNIRWMQAFVTDSGAELAPHGKTSMTPALFRRQLDAGAWGLT 80 L D+ LP V+ +AL HN+ WMQA+ G LAPHGKT+++P LF +QL AGAWGLT Sbjct: 34 LAGDLPLPIAVIRESALAHNLAWMQAYAERKGVALAPHGKTTLSPELFAQQLQAGAWGLT 93 Query: 81 LATAVQTRAAYAHGVRRVLMANQLVGTPNM----ALI---ADL----LADPAFEFHCMVD 129 AT Q G RR ++ANQ++ ++ AL+ ADL L D + C+ D Sbjct: 94 FATVYQLSVGVDAGARRAIIANQVLCDADLDGLHALLQRHADLRVWFLIDSLAQLRCIED 153 Query: 130 HPDNVADLGAFFASRGMKLNVMIEYGVVGGRCGCRTEAEVLALAEAIRSQPALALTGIEG 189 A+ A +L+ ++E GV G R GCRT E LALA+A+ PA+ L G+E Sbjct: 154 W----AERRGHTARGERRLDSLLEMGVQGQRTGCRTLEEALALAQAMAQSPAVQLGGVEC 209 Query: 190 YEGVI---HGDHAISGIRAFAASLVRLAVQLQDDDAFAIDKPIITASGSAWYDLIAESFE 246 YEG + +H + A + +A D FA + ++TA GSA +DL+ Sbjct: 210 YEGGVARCDSEHDAREVTALVRRVTEVARACDAQDLFADAEILLTAGGSAVFDLVIPLLR 269 Query: 247 AQNAHGRFLSVLRPGSYVAHDHGIYKEAQCCVLERRSDLHEGLRPALEVWAHVQSLPEPG 306 Q L VLR G Y+ HDHG Y+ V E+R L LRPALEVW VQS+PEPG Sbjct: 270 TQGLSKPVLGVLRSGCYITHDHGNYQRFLKHV-EQREGLDASLRPALEVWTLVQSVPEPG 328 Query: 307 FAVIALGKRDVAYDAGLPVPLKRYTPGSDSVPGDDVSGCKVTAVMDQHAFM--SVAAGVE 364 A++ G+RDV+YD +PVP+ R+ P + +G V+A+ D HA++ AA Sbjct: 329 LALLTGGRRDVSYDLEMPVPV-RWAPRHERRAASTPTGWTVSALNDHHAYLRYDPAADPA 387 Query: 365 LRVGDIIAFGTSHPCLTFDKWRVGCLVDEQLRVVESMETCF 405 VGD++A G SHPC TFDKWR +VD++ + ++ T F Sbjct: 388 PAVGDLVALGISHPCTTFDKWRWLPVVDDEGTITRAISTRF 428 Lambda K H 0.322 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 428 Length adjustment: 31 Effective length of query: 374 Effective length of database: 397 Effective search space: 148478 Effective search space used: 148478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory