Align glucokinase (EC 2.7.1.2) (characterized)
to candidate Ac3H11_2882 FIG01198523: hypothetical protein
Query= BRENDA::Q8RDE9 (315 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2882 Length = 412 Score = 186 bits (472), Expect = 8e-52 Identities = 96/310 (30%), Positives = 171/310 (55%), Gaps = 2/310 (0%) Query: 7 GVDLGGTKISTGIVDENGNIIKSIKIPTMAEKGPDVVIERIEESIYQVLKDTGLEMSNLK 66 G DLG T + ++ + ++ + P +GP V++ R+ + ++L GL + + Sbjct: 83 GADLGATSMQIAVMRPDMTVLARHREPIDVRQGPGVILARVRGLMRELLARCGLAPNQVI 142 Query: 67 GIGIGSPGPLNAKKGIVISPPNLPHWSNVPIVEILSKRLGIEVRLENDANAAAIGEHLFG 126 IG+G PGP++ + G +++PP +P W I + L + V ++ND N A+GE ++ Sbjct: 143 AIGMGVPGPVDFESGQLVNPPLMPDWDGFSIRDYLREAFAAPVFVDNDVNLMALGE-MYR 201 Query: 127 SGRGVDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTINFDGPRCNCGNYGCFEA 186 R + NF+ I V TGIG G++ G++Y G N +A ++GH ++ GPRC+CGN GC EA Sbjct: 202 LQRNLPNFLVIKVGTGIGCGIVCHGQVYRGANGSAGDVGHICVDQHGPRCHCGNQGCVEA 261 Query: 187 YASGTAIARFAREGIEKGIKTKIKE-LAGEGEVKAEHVFEAAKLGDEFAKELVEKEAFYL 245 A+ A+AR A E ++G + E L G + E V +A++ GD A ++++ + Sbjct: 262 MAAAPAMARMATEAAQRGESALLAERLQSTGALTIEDVAQASRTGDVAANAIIQRAGSLV 321 Query: 246 GVGIANIMAFYNPRKIAIGGGVSAQWDMLYEKMMETVRKKALKPNAEVCEVVKAQLGENI 305 G +A+I+ F+NP + I G V+ + + ++V ++L + E+ A L ++ Sbjct: 322 GQMLASIVNFFNPSHVFIAGRVTDMGPLFLASVRQSVYHRSLALSTRHLEIQYAPLADDA 381 Query: 306 GVLGAAALLL 315 GV+GA L + Sbjct: 382 GVVGAGVLAM 391 Lambda K H 0.316 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 412 Length adjustment: 29 Effective length of query: 286 Effective length of database: 383 Effective search space: 109538 Effective search space used: 109538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory