Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate Ac3H11_3227 TRAP-type C4-dicarboxylate transport system, large permease component
Query= uniprot:Q88NP0 (426 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3227 Length = 434 Score = 299 bits (766), Expect = 1e-85 Identities = 161/422 (38%), Positives = 260/422 (61%), Gaps = 14/422 (3%) Query: 3 AFILLG-SFIVLILIGMPVAYALGLSALIGAWWIDI-PLQAMMIQVASGVNKFSLLAIPF 60 AF++ +VL+ GM + AL L+ AW +D Q + + +GV+ F LLA+PF Sbjct: 11 AFVVFSLGMLVLMGTGMNMGLALVLTGAGMAWVLDFWDAQLLAQNLVAGVDSFPLLAVPF 70 Query: 61 FVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSV 120 F+LAG +M GG+SRR++ A VG +RGGL V I A+ ++SGS++ADTA++ ++ Sbjct: 71 FILAGELMNSGGISRRIIDMAQAWVGHIRGGLGYVAIGAAVLMASMSGSALADTAALATI 130 Query: 121 LIPEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGL 180 L+P M ++GYP S + SG + A + PPS V+Y + SI++LF++GI+PGL Sbjct: 131 LLPMMRQQGYPMNTSAGLIASGGIIAPIIPPSMPFVIYGVTTN--TSISALFVSGIVPGL 188 Query: 181 LLSAVMMGLCLIFA-----KKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGV 235 MMG+ LIFA + + P+GE +P+++ L+ A W ++ +II+GG+ +GV Sbjct: 189 -----MMGVGLIFAWRWVLRDLDLPQGEPLPVKDRLRATARAFWAMLMPLIIIGGMKTGV 243 Query: 236 FTATESAAVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTL 295 FT TE+A VA ++ V +FI+R+ K D+ ++ R +T SIVM L A Y++TL Sbjct: 244 FTPTEAAVVAAFYALVVALFIHREMKLADIYGVLVRAAKTTSIVMFLCAGAQVASYMITL 303 Query: 296 MQIPSKITTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDP 355 +P+ +T+ L +N +++ + +L+L+GT +D+ P ILI P++LP+ G+DP Sbjct: 304 ADLPNVLTSWLGPLVENPRLLMAVMMIVLVLIGTALDLTPTILIFAPVMLPIAVKAGIDP 363 Query: 356 VHFGMIMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIP 415 V+FG++ ++N IGLITPPVG VL V + +G++S+ S +K + PF L+L + P Sbjct: 364 VYFGLMFVLNGAIGLITPPVGTVLNVVAGVGRISMHSVIKGVNPFLFTYVLILALLVVFP 423 Query: 416 AI 417 I Sbjct: 424 QI 425 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 31 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 434 Length adjustment: 32 Effective length of query: 394 Effective length of database: 402 Effective search space: 158388 Effective search space used: 158388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory