Align Putative TRAP dicarboxylate transporter, DctQ subunit (characterized, see rationale)
to candidate Ac3H11_3956 TRAP-type C4-dicarboxylate transport system, small permease component
Query= uniprot:Q88NN9 (194 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3956 Length = 172 Score = 211 bits (537), Expect = 6e-60 Identities = 101/171 (59%), Positives = 136/171 (79%), Gaps = 4/171 (2%) Query: 24 FLSVNDTLYRSCIWIAGLSILAMTLIIPWGIFARYVLGTGSSWPEPVSILLMVVFTFVGA 83 FL D LY + IW AG +I M+LIIPWG+F+RYV+GTGS WPEP++ILLM+VFTF+GA Sbjct: 5 FLRWMDRLYLATIWAAGTAIFFMSLIIPWGVFSRYVMGTGSQWPEPIAILLMMVFTFIGA 64 Query: 84 AASYRAGAHMAVGMITDRLP-PLQRQLVALLVQLLMIVVCVFMTYYGTRLCITTWNQSLA 142 AA+YRAG H+AV M+T++LP PLQR L+A+LV +LM+V+C F+ +YGT LCI TW Q +A Sbjct: 65 AAAYRAGGHIAVNMLTEKLPAPLQR-LLAVLVDVLMLVICGFVAWYGTNLCIETWGQGIA 123 Query: 143 SLPGVRVGMTYAPIPVGGVLTLVFVLEKLLLGDQSNRKVVRFDLVEENEGA 193 LP + VG TYA +P+G +TL+FVLEK++ G Q++R++VRF+ E EGA Sbjct: 124 ELPWLPVGATYASLPIGAAVTLLFVLEKMVFGPQNHRRIVRFE--ELTEGA 172 Lambda K H 0.328 0.141 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 172 Length adjustment: 19 Effective length of query: 175 Effective length of database: 153 Effective search space: 26775 Effective search space used: 26775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory