Align tartronate semialdehyde reductase 2 (characterized)
to candidate Ac3H11_1088 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1088 Length = 322 Score = 391 bits (1005), Expect = e-114 Identities = 202/294 (68%), Positives = 237/294 (80%), Gaps = 4/294 (1%) Query: 1 MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVETARQVTEASDIIF 60 +KLGFIGLGIMG PM +L AGHQL+V T G VA ++ A TAR V E +DI+F Sbjct: 24 LKLGFIGLGIMGAPMCGHLIAAGHQLYVHTRGRVAPQIAQSSATQCTTARGVAERADIVF 83 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKG---KTIVDMSSISPIETKRFARQVNELGGDYLDA 117 +M+PDTP VE+VLFG +G + LKG K +VDMSSISP+ TK FA ++ +G YLDA Sbjct: 84 LMLPDTPDVEKVLFGADGVAQG-LKGSVGKVVVDMSSISPVATKDFAARIEAVGAQYLDA 142 Query: 118 PVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVA 177 PVSGGE+GA+ TLSIMVGG EAVFER++PLFE LGKNITLVGGNGDGQT KVANQIIVA Sbjct: 143 PVSGGELGAKNATLSIMVGGPEAVFERIRPLFERLGKNITLVGGNGDGQTAKVANQIIVA 202 Query: 178 LNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQK 237 LNIEAV+EALLFA++AGADP RVRQAL+GGFASS+ILEVH ERMIKRTF+PGF+I LHQK Sbjct: 203 LNIEAVAEALLFAARAGADPARVRQALLGGFASSKILEVHAERMIKRTFDPGFRIGLHQK 262 Query: 238 DLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKL 291 DLNLAL SA+AL + LPNTA QELFN C A+GG DHSA+V+ALE MAN ++ Sbjct: 263 DLNLALSSARALGVPLPNTAMAQELFNACVAHGGQGWDHSAMVRALEKMANFEM 316 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 322 Length adjustment: 27 Effective length of query: 265 Effective length of database: 295 Effective search space: 78175 Effective search space used: 78175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_1088 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.13073.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-127 409.3 4.3 4.8e-127 409.1 4.3 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 2-hydroxy-3-oxopropionate reduct Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 409.1 4.3 4.8e-127 4.8e-127 1 290 [. 25 315 .. 25 316 .. 0.98 Alignments for each domain: == domain 1 score: 409.1 bits; conditional E-value: 4.8e-127 TIGR01505 1 kvgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtm 62 k+gfiGlGimG Pm+ l+ aG+ql v t++ ++ +++ a+ ta+ v+e ad+++ m lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 25 KLGFIGLGIMGAPMCGHLIAAGHQLYVHTRG-RVAPQIAQSSATQCTTARGVAERADIVFLM 85 89*****************************.89999************************* PP TIGR01505 63 vPdsPqveevalGenGileaak..kGkvlvdmssiaPleskelakavkekGidvldaPvsGG 122 +Pd+P+ve+v++G +G+ ++ k Gkv+vdmssi+P+++k++a +++ G ++ldaPvsGG lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 86 LPDTPDVEKVLFGADGVAQGLKgsVGKVVVDMSSISPVATKDFAARIEAVGAQYLDAPVSGG 147 ******************98763369************************************ PP TIGR01505 123 eagaiegtlsimvGGdkavfdkvkpllealgksivlvGenGaGqtvkvanqvivalnieavs 184 e ga+++tlsimvGG +avf++++pl+e lgk+i+lvG+nG+Gqt+kvanq+ivalnieav+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 148 ELGAKNATLSIMVGGPEAVFERIRPLFERLGKNITLVGGNGDGQTAKVANQIIVALNIEAVA 209 ************************************************************** PP TIGR01505 185 ealvlaekaGvdpkavlqalrGGlagstvleakkerlldrdfkPGfridlhqkdlalaldaa 246 eal++a +aG+dp +v+qal GG+a+s++le+++er+++r+f+PGfri lhqkdl+lal +a lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 210 EALLFAARAGADPARVRQALLGGFASSKILEVHAERMIKRTFDPGFRIGLHQKDLNLALSSA 271 ************************************************************** PP TIGR01505 247 kavgaalPvtavvaellaalradGdgtldhsalvraleklakdk 290 +a+g+ lP+ta+ +el++a+ a+G+ + dhsa+vralek+a+ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1088 272 RALGVPLPNTAMAQELFNACVAHGGQGWDHSAMVRALEKMANFE 315 *****************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (322 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.80 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory