Align tartronate semialdehyde reductase 2 (characterized)
to candidate Ac3H11_1664 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1664 Length = 294 Score = 211 bits (538), Expect = 1e-59 Identities = 118/280 (42%), Positives = 175/280 (62%), Gaps = 3/280 (1%) Query: 1 MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVE-TARQVTEASDII 59 +++ +G+G+MG PMA L+ AGH + E L+L V+V T + + +DI+ Sbjct: 6 LRIAVLGIGMMGLPMARRLSEAGHPVRAWNRTRAKAEPLALYGVTVSNTPAEAVQDADIV 65 Query: 60 FIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPV 119 ++ + P V +VLF + G +A +G +DM+SI P E + A ++ ELG +LDAPV Sbjct: 66 ISLLENGPVVGQVLF-DQGAARAMRRGSLFIDMASIQPSEARDHAARLGELGVAHLDAPV 124 Query: 120 SGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALN 179 SGG +GA GTL+IMVGG ++R P+F LG+ T VG +G GQ K+ANQ+IV + Sbjct: 125 SGGTVGAEAGTLAIMVGGRPEDYQRALPVFAPLGR-ATHVGPHGAGQLAKLANQMIVGIT 183 Query: 180 IEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDL 239 I AV+EALLFA+K GAD +VR+A+ GGFA SRIL++HG+RM++R F P ++A+ KD+ Sbjct: 184 IGAVAEALLFAAKGGADMAKVREAISGGFADSRILQLHGQRMVERDFAPRGRMAVQLKDM 243 Query: 240 NLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAL 279 A+ +A + P TA + L+ +G LDHS L Sbjct: 244 RNAMATAHETGFDAPITALFEALYADGVEHGLGDLDHSGL 283 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 294 Length adjustment: 26 Effective length of query: 266 Effective length of database: 268 Effective search space: 71288 Effective search space used: 71288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory