Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate Ac3H11_2362 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)
Query= BRENDA::Q8ZLV8 (296 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2362 Length = 294 Score = 185 bits (469), Expect = 1e-51 Identities = 108/293 (36%), Positives = 163/293 (55%), Gaps = 7/293 (2%) Query: 3 MKVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVI 62 MK+ FIGLG MG PM+ NL KAG+ + D + A + A G A+ AKA +V+ Sbjct: 1 MKIAFIGLGNMGGPMAHNLHKAGHEVRAFDLSQPARDKLAADGVPIATDAKAAVAGAEVV 60 Query: 63 ITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPV 122 I+MLP S HV+ + LG ++ GT++ID S+IA SR+++DA KAKGV +DAPV Sbjct: 61 ISMLPASQHVEGLFLGAGELLAQLPAGTLIIDCSTIAAATSRKVADAAKAKGVAFIDAPV 120 Query: 123 SGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIVALN 182 SGG AI GTL+ MVGGD A ++ +++ M ++ H G +GAG K+ N +++ + Sbjct: 121 SGGTGGAIAGTLTFMVGGDAADLERARPVLEKMGANIFHAGSVGAGQTAKICNNMLLGIL 180 Query: 183 IAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPM--VMD-----RNFKPGFRI 235 +A SEA+ L G++P ++ + +R G+ L+ P VM+ + + GF Sbjct: 181 MAGTSEAIALGVANGLDPKVLSEIMRRSSGGNWALEKYNPFPGVMEXAPASKGYAGGFGT 240 Query: 236 DLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSALACYYEK 288 DL +KDL A + + V A PL + A GHG D S++ +K Sbjct: 241 DLMLKDLGLAQENAMAVKAATPLGGMARNLYAAHSLAGHGGLDFSSIIKMVQK 293 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 294 Length adjustment: 26 Effective length of query: 270 Effective length of database: 268 Effective search space: 72360 Effective search space used: 72360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory