Align aspartate ammonia-lyase (EC 4.3.1.1) (characterized)
to candidate Ac3H11_943 Fumarate hydratase class II (EC 4.2.1.2)
Query= BRENDA::Q9LCC6 (468 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_943 Length = 469 Score = 367 bits (942), Expect = e-106 Identities = 193/458 (42%), Positives = 281/458 (61%), Gaps = 1/458 (0%) Query: 3 TDVRIEKDFLGEKEIPKDAYYGVQTIRATENFPITGYRIHPELIKSLGIVKKSAALANME 62 T VR EKD G ++P D +G QT R+ +F I+G R+ PELI++L VK+++A N Sbjct: 9 TAVRTEKDTFGPIDVPADRLWGAQTQRSLHHFAISGERMAPELIRALAQVKRASAYVNHA 68 Query: 63 VGLLDKEVGQYIVKAADEVIEGKWNDQFIVDPIQGGAGTSINMNANEVIANRALELMGEE 122 +GLLD IV AADEVI G +F + Q G+GT NMN NEV+ANRA EL+G Sbjct: 69 LGLLDAAKTTAIVAAADEVIGGGHLQEFPLVVWQTGSGTQTNMNMNEVLANRASELLGGP 128 Query: 123 KGNYSKISPNSHVNMSQSTNDAFPTATHIAVL-SLLNQLIETTKYMQQEFMKKADEFAGV 181 +G + PN VN SQS+ND FPTA H+A + +L+++L+ ++ KA F G+ Sbjct: 129 RGEARLVHPNDEVNKSQSSNDVFPTAMHLAAVDALMHRLLPALHGLRTTLAAKARAFDGI 188 Query: 182 IKMGRTHLQDAVPILLGQEFEAYARVIARDIERIANTRNNLYDINMGATAVGTGLNADPE 241 +K+GRTHLQDA P+ LGQE + + + + +L ++ +G TAVGTGLNA Sbjct: 189 VKIGRTHLQDATPLTLGQEISGWVAQLQHGEQHVRAALPHLGELALGGTAVGTGLNAPAG 248 Query: 242 YISIVTEHLAKFSGHPLRSAQHLVDATQNTDCYTEVSSALKVCMINMSKIANDLRLMASG 301 Y V + LA +G PL +A + +A + D ALK ++ KIAND+R +ASG Sbjct: 249 YAQAVAKELADLTGLPLVTAPNKFEALASCDALVHAHGALKTLAASLMKIANDVRWLASG 308 Query: 302 PRAGLSEIVLPARQPGSSIMPGKVNPVMPEVMNQVAFQVFGNDLTITSASEAGQFELNVM 361 PR+GL EI +P +PGSSIMPGKVNP E + + QV GND+ I +G FELNV Sbjct: 309 PRSGLGEIAIPENEPGSSIMPGKVNPTQCEALTMLCAQVLGNDVAINIGGASGNFELNVF 368 Query: 362 EPVLFFNLIQSISIMTNVFKSFTENCLKGIKANEERMKEYVEKSIGIITAINPHVGYETA 421 P++ N +QS+ ++ + SF E+C GI N+ R+ + VE+S+ ++TA+NPH+GY+ A Sbjct: 369 RPLVIHNFLQSVRLLADGMTSFNEHCAVGIAPNQARINDLVEQSLMLVTALNPHIGYDKA 428 Query: 422 AKLAREAYLTGESIRELCIKYGVLTEEQLNEILNPYEM 459 A +A++A+ G S+R + G +T EQ ++ + P +M Sbjct: 429 AFIAKKAHKEGTSLRAAAVASGHVTGEQFDQWVVPGQM 466 Lambda K H 0.316 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 469 Length adjustment: 33 Effective length of query: 435 Effective length of database: 436 Effective search space: 189660 Effective search space used: 189660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory