Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate Ac3H11_3200 Amino acid ABC transporter permease protein
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3200 Length = 604 Score = 101 bits (251), Expect = 4e-26 Identities = 73/219 (33%), Positives = 118/219 (53%), Gaps = 15/219 (6%) Query: 16 LLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSIPLVMVLLWF 75 +L GL TL +T + G GT LA+ R+S +A + ++ +FRSIP++++LL Sbjct: 82 VLVGLGRTLLLTALGALFGFTLGTALALARVSRSPLLAGLSWTFIWIFRSIPVIVLLLII 141 Query: 76 YLIVPGFLQNVLGLS-PKND--------IRLIS----AMVAFSMFEAAYYSEIIRAGIQS 122 + G+L + + P D +LIS A++ ++ +AA+ SEI+R GI S Sbjct: 142 NNL--GYLYETVSVGLPFTDWTFFSYPTTQLISPFVAALIGLTLNQAAFASEIVRGGILS 199 Query: 123 ISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFR 182 + +GQ AA ALG+ + I+LPQA R+++P I L + TS VY+L+L + F Sbjct: 200 VDQGQLEAAAALGLPRRRQAFRIVLPQAMRSILPAGFNDIIGLAKGTSNVYILALPELFY 259 Query: 183 TASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKR 221 T I R+ + +++ A Y VI SLL Y++R Sbjct: 260 TIQIIYRRNLEVIPLLMVATVWYLVILTVLSLLQYYIER 298 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 604 Length adjustment: 29 Effective length of query: 195 Effective length of database: 575 Effective search space: 112125 Effective search space used: 112125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory