Align Aquaporin-3, Aqp-3 of 271 aas (characterized)
to candidate Ac3H11_4644 Aquaporin Z
Query= TCDB::729057658 (271 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4644 Length = 248 Score = 83.2 bits (204), Expect = 5e-21 Identities = 73/228 (32%), Positives = 108/228 (47%), Gaps = 25/228 (10%) Query: 28 AEFLGTALI----CYVSVIYQHGP------VPAAFVVGLTLAWIAWVFGPVSGAHVNPVV 77 AEFLGT + C +V+ P + + GLT+ A+ GP+SG H NP V Sbjct: 27 AEFLGTFWLTFGGCGSAVLAAAFPQLGIGFLGVSLAFGLTVLTGAYALGPISGGHFNPAV 86 Query: 78 SLMMLLVRKVWFLDALIYIVAQLLGSMAGSWIGTLAV---PAVDAGN--TLGMTTIS-AN 131 S+ + L + + Y+VAQ+LG++ + + L P D G T G S Sbjct: 87 SVGLALGGRFKVSELPGYVVAQVLGAIVAAGVLYLIATGKPGADIGGFATNGYGEHSPGG 146 Query: 132 ITVGQAIGLEIVATALLLLVILSAVDELRPKPWNVGNVTIFPFIFGATLALLASLLGDLT 191 + A+ E+V TA+ L+VIL R VG + I G L L+ + +T Sbjct: 147 YGLLAAVVAEVVLTAVFLIVILGVTS--RRAAEGVGGMAI-----GLCLTLIHLISIPVT 199 Query: 192 GASMNPARSFGPAVVNNNF--TDLWVYIVGPFIGALLATVLYEFLLTE 237 S+NPARS GPA+ ++ ++LWV+ P GALL +Y L E Sbjct: 200 NTSVNPARSTGPALFGPSYALSELWVFWAAPIAGALLGAAIYRGLFGE 247 Lambda K H 0.326 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 248 Length adjustment: 24 Effective length of query: 247 Effective length of database: 224 Effective search space: 55328 Effective search space used: 55328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory