Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate Ac3H11_2497 Alcohol dehydrogenase (EC 1.1.1.1)
Query= BRENDA::A4IP64 (395 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2497 Length = 378 Score = 171 bits (433), Expect = 3e-47 Identities = 113/352 (32%), Positives = 191/352 (54%), Gaps = 20/352 (5%) Query: 16 WGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHVYTDVVPEPPLE 75 +GA+ L E R+G L++TDP + G++ + L G +V V+ D P P E Sbjct: 14 FGAVQLLKQECGRVGITRPLIVTDPGVKAAGVLQKALDAL--PGMTVAVF-DQTPSNPTE 70 Query: 76 TGEKA-VAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLTG-TRTLEKKG 133 +A V + D +I VGGGSA+D AK A+ A H+G + Y + G + + + Sbjct: 71 AAVRAAVEMYKAQGCDGLIAVGGGSAIDCAKGIAIAATHEGPLTHYATIEGGSPRITDRA 130 Query: 134 LPKILIPTTSGTGSEVTNISVLSLETTKDVVTHDY-LLADVAIVDPQLTVSVPPRVTAAT 192 P I +PTTSGTGSEV +++ ++ + + H + L+ AI DP+LT+ +PP +TAAT Sbjct: 131 APLIAVPTTSGTGSEVARGAIIIVDDHRKLGFHSWNLVPKTAICDPELTLGLPPMLTAAT 190 Query: 193 GIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQARIDMANGSYLAG 252 G+DA+ H +E ++S +P +DG+A+ + ++ +A NGSD+ AR+ M + S + G Sbjct: 191 GMDAIAHCMETFMSAAFNPPADGIALDGLTRGWANIEQATKNGSDRDARLHMMSAS-MQG 249 Query: 253 LAFFNAGVAGVHALAYPLGG-QFHIAHGESNAVLLPYVMGYIRQSCT----KRMADIFNA 307 F G+ VH+L++ LGG + HG NA+ LP V+ + Q+ + KR+ + +A Sbjct: 250 AMAFQKGLGAVHSLSHSLGGVNPRLHHGTLNAMFLPAVVRFNAQAESVQKEKRLERMAHA 309 Query: 308 LGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAV 359 +G + ++ E + A +G+P L G+ E+ + + K A+ Sbjct: 310 MG--------LASAGDIPEAIRDMNARLGLPTGLAAMGVNEAMFDDIIKGAM 353 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 378 Length adjustment: 30 Effective length of query: 365 Effective length of database: 348 Effective search space: 127020 Effective search space used: 127020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory