Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate Ac3H11_2066 SN-glycerol-3-phosphate transport ATP-binding protein UgpC (TC 3.A.1.1.3)
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2066 Length = 355 Score = 202 bits (515), Expect = 8e-57 Identities = 127/360 (35%), Positives = 206/360 (57%), Gaps = 17/360 (4%) Query: 5 SLDLAHSYKPNPQQDSDYALL-PLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHG 63 SLD+A K + D +L + + G L+GPSGCGK+T+LNI++GL P+ G Sbjct: 4 SLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEG 63 Query: 64 KVLFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIA 123 ++ G++V P++R+IA VFQ +Y T++VA+N+ F L RK+P+ + ++R+ +A Sbjct: 64 EIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEVA 123 Query: 124 EMLEMSGQLNQRAAGLAADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLK 183 ML++S L++R + L+ +Q++++GR L R LFDEPL+ +D L+ ++R ++K Sbjct: 124 AMLQISHLLDRRPSQLSGGQRQRVAMGRALAR-QPQLFLFDEPLSNLDAKLRVEMRAEIK 182 Query: 184 QIHHELKLTLIYVTHDQVEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSP 243 ++H +T +YVTHDQVEA+T ++ VM G Q+G+ D ++ RPA+T+V FIGSP Sbjct: 183 RLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIGSP 242 Query: 244 GMNFLPAHRDGENLSVAGH--RLASPVGRALPAGALQVGIRPEYLALAQPQQAGALPGTV 301 MN L G + G LA P A + +G+RPE+L + Q+ G V Sbjct: 243 TMNLLRGAVTGGQFGIQGAALNLAPPPS---SANEVLLGVRPEHLVM---QETAPWRGRV 296 Query: 302 VQVQDIG--TYQMLTAKVGEHTVKARFTPETRLPSSGDTAWLQVLGEHTCYY--KNEELL 357 V+ G TY M+ G +V R +TR+ G+ L + H ++ ++EE L Sbjct: 297 SVVEPTGPDTYVMVDTAAG--SVTLRTDAQTRV-QPGEHVGLALAPAHAHWFDAQSEERL 353 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 355 Length adjustment: 29 Effective length of query: 329 Effective length of database: 326 Effective search space: 107254 Effective search space used: 107254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory