Align ABC transporter related (characterized, see rationale)
to candidate Ac3H11_2553 Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2553 Length = 265 Score = 243 bits (619), Expect = 4e-69 Identities = 130/254 (51%), Positives = 172/254 (67%), Gaps = 7/254 (2%) Query: 3 ATAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDD 62 A P+ + ++ + K+FG H VL GI D V+ ++G SGSGKSTFLRC N LE P+ Sbjct: 14 AAEPI-VRIRGLRKAFGSHVVLNGIDFDVLPSQVVVVIGPSGSGKSTFLRCCNGLEQPEG 72 Query: 63 GSVSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMR 122 GSV + G L DG++ P ++ +R ++GMVFQ+FNL+ H++VL+N+ GP + Sbjct: 73 GSVEICGRTLVQ----DGRMLPD--HDLNALREEVGMVFQSFNLFPHLSVLDNVTLGPRK 126 Query: 123 VQKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPT 182 ++ SR E+ E A+ALL KVGLA K PA LSGGQ+QRVAIARALAM P+VMLFDEPT Sbjct: 127 LRGLSRKEAEERAQALLTKVGLAHKAPAMPASLSGGQKQRVAIARALAMEPRVMLFDEPT 186 Query: 183 SALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVF 242 SALDPELVGEVL+VM+ LA EG TM+VVTHEM FAR V + V+ + G + G P +F Sbjct: 187 SALDPELVGEVLQVMKLLASEGMTMMVVTHEMDFAREVGDVVVVMDGGGIIEAGAPATIF 246 Query: 243 VECKSDRFRQFVSS 256 +R R F+ + Sbjct: 247 TNPTQERTRSFLQA 260 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 265 Length adjustment: 25 Effective length of query: 238 Effective length of database: 240 Effective search space: 57120 Effective search space used: 57120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory