Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate Ac3H11_2555 Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)
Query= TCDB::Q9HU31 (250 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2555 Length = 249 Score = 117 bits (292), Expect = 3e-31 Identities = 75/244 (30%), Positives = 127/244 (52%), Gaps = 8/244 (3%) Query: 5 KKILLAAAATLAFALDASAADK--LRIGTEGAYPPFNGIDASGQAVGFDLDIGKALCAKM 62 + +LLA+ A AF + A LR+GT+ +PP ++ +G+ GFD+++ +A+ M Sbjct: 5 RNLLLASLAAAAFCTTGAQAQDNVLRVGTDATFPPMEFVE-NGKRTGFDIELVEAIAKTM 63 Query: 63 KTECEVVTSDWDGIIPALNAKKFDFIVASMSITDERKQAVDFTDPYYTNKLQFVAPKSVD 122 + E V D+ G+IP L +K+FD V+++ ITDERK+ VDFTD YY L + Sbjct: 64 GKQVEWVDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKADNK 123 Query: 123 FKTDKDSLKGKVIGAQRATIAGTWLEDNMADVVTIKLYDTQENAYLDLSSGRLDGVLADK 182 L GK + Q T + ++L + V +++ QE L + GR D + K Sbjct: 124 AINKLADLDGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQEMFNL-VDIGRADAAVTGK 182 Query: 183 FVQYDWLKSDAGKEFEFKGEPVFDNDKIGIAVRKGDP-LREKLNAALKEIVADGTYKKIN 241 + ++++ G + ++ G+A+RK P L + +N A+ ++ ADGTY I Sbjct: 183 PAAFQYVRTRPGLRVL---DEQLTTEEYGMALRKDTPELTKAVNGAITKLKADGTYAAIV 239 Query: 242 DKYF 245 K+F Sbjct: 240 KKWF 243 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 249 Length adjustment: 24 Effective length of query: 226 Effective length of database: 225 Effective search space: 50850 Effective search space used: 50850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory