Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate Ac3H11_1259 N-formylglutamate deformylase (EC 3.5.1.68)
Query= reanno::Cup4G11:RR42_RS16895 (271 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1259 Length = 310 Score = 101 bits (251), Expect = 2e-26 Identities = 87/290 (30%), Positives = 131/290 (45%), Gaps = 30/290 (10%) Query: 1 MAFSTDTPAFTLHRGTRPMLVSMPHVGTHLPACVSDRLT-AEARTVPDTDWHLERLYDFA 59 MA + T G+ P+++ PH GT PA A R DT H+E++Y FA Sbjct: 25 MAATPSAATVTAVPGSTPLVLDSPHSGTQYPADFGSACDLATLRRAEDT--HVEKIYAFA 82 Query: 60 RELGASILVATHSRYVVDLNRPPDNANL------YPGQDTT------------GLCPVDT 101 LG + + A R +D NR + +P +T GL T Sbjct: 83 PALGVAWVEAHFPRIYLDANRDTTELDTSLLDGDWPDPISTDPKVLSKVRLGKGLVWKFT 142 Query: 102 FDKTPIYADASGLPADDEIAARRDAIWRPYHGALAEELARLRAEHGTVALWDAHSIRSVL 161 + PIY L E+ AR D WRPYH A+A+ + A HG + HS+ +V Sbjct: 143 DEGEPIY---HRLLTVAEVRARIDRCWRPYHAAVAQAIDAAHARHGYSIHLNCHSMPAVA 199 Query: 162 PRF---FEG-KLTDFNLGTANGASCDAALANQLLDIAGALPGYTSVLNGRFKGGYITRQY 217 RF F G + DF +G +G + AL+ + + A GY+ N +KG + R+Y Sbjct: 200 GRFATEFPGLEHADFVVGDRDGTTASPALSALICEHLRAC-GYSVEYNHPYKGVELVRRY 258 Query: 218 GAPAQGVQAVQLELTQSAYMSETYPFAYDEARATRIQPTLKTMLETVLGY 267 G PAQ ++Q+E+ + YM E E A R+Q LK +++ +L + Sbjct: 259 GHPAQHRHSIQVEINRKLYMDEQTLAQVPEGMA-RLQADLKALVQKLLAH 307 Lambda K H 0.320 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 310 Length adjustment: 26 Effective length of query: 245 Effective length of database: 284 Effective search space: 69580 Effective search space used: 69580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory