Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate Ac3H11_909 Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_909 Length = 374 Score = 154 bits (388), Expect = 4e-42 Identities = 83/236 (35%), Positives = 133/236 (56%), Gaps = 10/236 (4%) Query: 38 VLAETGCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDIL 97 V + G + D+SL I +GE+ ++G SG GK+TL+R L G I GED Sbjct: 8 VSKQFGDFQALRDVSLDIQSGELIALLGPSGCGKTTLLRIIAGLETADVGTIHFSGEDTT 67 Query: 98 QLDMDALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCA----ERALHWI 153 + + R + VFQ + L H +V +NVA+GL+V+ S++ ++ + + Sbjct: 68 DVHV------RERNVGFVFQHYALFRHMTVFENVAFGLRVKPRSERPSEAQIKKKVMDLL 121 Query: 154 NTVGLKGYENKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLE 213 V L +YP QLSGG RQR+ LARALA + ++L+DE F ALD +R E++ L Sbjct: 122 KLVQLDWLAERYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLRR 181 Query: 214 LQKTLHKTIVFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 L LH T +F+THD +EA+ + +R+ ++ G++ Q G+P+++ PA +V F+ Sbjct: 182 LHDELHVTSIFVTHDQEEALEVADRVVVINQGRIEQSGSPQQVWDQPASPFVYGFL 237 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 374 Length adjustment: 28 Effective length of query: 248 Effective length of database: 346 Effective search space: 85808 Effective search space used: 85808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory