Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate Ac3H11_1916 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
Query= SwissProt::O32177 (391 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1916 Length = 399 Score = 341 bits (874), Expect = 2e-98 Identities = 184/393 (46%), Positives = 257/393 (65%), Gaps = 5/393 (1%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59 +++A IV+ RTP+G++ +G RPDDL +K + + + I+D IIGC+ P Sbjct: 6 VQDAYIVAATRTPIGRSGRGYFKNTRPDDLLVAAIKSAMLQVPTLDPKAIEDAIIGCSFP 65 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 E EQG+NMAR LA + V +TVNR+C+SG+ ++ AA++I +G D IAGGAES Sbjct: 66 EGEQGMNMARIAVGLA-FNHPVGGVTVNRFCASGITALQMAADRIRVGEADVLIAGGAES 124 Query: 120 MSQVPMMGHVTRPNLALAEKAPEYYMS--MGHTAEQVAKKYGVSREDQDAFAVRSHQNAA 177 MS VPM G+ N + + + ++ MG TAE+VA+++ +SRE QDAFA+ SH A Sbjct: 125 MSLVPMGGNKPSFNAEVFARDEDVGIAYGMGLTAEKVAQQWKISREAQDAFALESHLRAI 184 Query: 178 KALAEGKFKDEIVPVEVTVTEIG-EDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSV 236 KA G+F DEI P EV + +EK+ S DEG RP T+ + L+ L+P F+ Sbjct: 185 KAQKAGEFTDEITPFEVVERSPNLATGEVVEKRRTVSLDEGPRPDTSLEGLAKLKPVFAA 244 Query: 237 DGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIP 296 G+VTAGNSSQTSDGA A+++ + GL PL +F S+A GVPPE+MGIGP+EAIP Sbjct: 245 RGSVTAGNSSQTSDGAGALIVASEKAVKQFGLTPLARFVSYAARGVPPEIMGIGPIEAIP 304 Query: 297 RALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKL 356 AL+ AGL+ DIG +ELNEAFA+Q++ VI LG++ VN GGAIALGHPLG TG Sbjct: 305 AALRYAGLKSDDIGWYELNEAFAAQSLAVINTLGLNPANVNPMGGAIALGHPLGATGAIR 364 Query: 357 TLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 +++H ++R ++G+VTMC+G G GAAG+ E Sbjct: 365 AATVVHALRRHKLKYGMVTMCVGTGQGAAGIIE 397 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 399 Length adjustment: 31 Effective length of query: 360 Effective length of database: 368 Effective search space: 132480 Effective search space used: 132480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_1916 (3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9))
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.1895766.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-139 449.9 1.5 3.9e-139 449.8 1.5 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 3-ketoacyl-CoA thiolase (EC 2.3. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 449.8 1.5 3.9e-139 3.9e-139 1 385 [] 11 397 .. 11 397 .. 0.96 Alignments for each domain: == domain 1 score: 449.8 bits; conditional E-value: 3.9e-139 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.an 59 iv+a+Rtpig + +g +k+++++dLl+a+ik+++ ++ ldp++i+++i+G+++++geq +n lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 11 IVAATRTPIGrSGRGYFKNTRPDDLLVAAIKSAMLQVpTLDPKAIEDAIIGCSFPEGEQgMN 72 8*********9889***********************9*********************999 PP TIGR01930 60 iaReaalaaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillk 121 +aR a+ +++ v ++tvnr+CaSg++A+++aa++i++Geadv++aGG+EsmS vp++ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 73 MARI-AVGLAFNHPVGGVTVNRFCASGITALQMAADRIRVGEADVLIAGGAESMSLVPMGGN 133 9996.678889************************************************999 PP TIGR01930 122 aslrreslklgk.akledqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaak 182 + s++ + a++ed v ++ mg tAe++a++++isRe qD++al+Sh +a k lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 134 KP----SFNAEVfARDED------VGIAYGMGLTAEKVAQQWKISREAQDAFALESHLRAIK 185 86....344433044444......5578********************************** PP TIGR01930 183 Aieegkfkdeivpvevkgk............kkvvskDegirpnttlekLakLkpafkekkg 232 A+++g+f dei+p+ev ++ ++vs Deg+rp+t+le LakLkp+f+ g lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 186 AQKAGEFTDEITPFEVVERspnlatgevvekRRTVSLDEGPRPDTSLEGLAKLKPVFAA-RG 246 ****************9999*********99999***********************96.8* PP TIGR01930 233 stvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaL 294 s vtAgNssq++DGA+al+++se+++k++gltplar+vs+a gv+pe+mg+gp++Ai++aL lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 247 S-VTAGNSSQTSDGAGALIVASEKAVKQFGLTPLARFVSYAARGVPPEIMGIGPIEAIPAAL 307 7.************************************************************ PP TIGR01930 295 kkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltl 356 + agl+ +di ++E+nEAFAaq lav++ lg l++++vN GGAiAlGHPlGa+Ga+ +t+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 308 RYAGLKSDDIGWYELNEAFAAQSLAVINTLG-LNPANVNPMGGAIALGHPLGATGAIRAATV 368 *******************************.88**************************** PP TIGR01930 357 lkeLkergkkyGlatlCvggGqGaAvile 385 +++L++++ kyG++t+Cvg+GqGaA i+e lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1916 369 VHALRRHKLKYGMVTMCVGTGQGAAGIIE 397 **************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.29 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory