Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate Ac3H11_2762 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= BRENDA::Q99714 (261 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2762 Length = 255 Score = 114 bits (284), Expect = 3e-30 Identities = 89/257 (34%), Positives = 127/257 (49%), Gaps = 26/257 (10%) Query: 14 VITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQT 73 +ITGGASG+G L G GA V +DL GEA AK G F DV E V Sbjct: 12 LITGGASGMGEGLVRSLTGMGALVVSMDLNRERGEAVAKAAGARG-FMEVDVADEGSVAR 70 Query: 74 ALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVA 133 A+ A + G +DV ++ AGIA +S Q +L +++V VN GTF + R V Sbjct: 71 AVDAACTRLGGLDVLIHAAGIAPSSPA------QGTSLALWEKVFAVNATGTFLMNRAVF 124 Query: 134 GEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRV 193 M + Q G IIN AS A G ++AYSA+KG ++ T +A++ P IRV Sbjct: 125 PHMRE-------QGGSIINFASAAGALGLPNKSAYSAAKGAVLAWTRTVAQEWGPYNIRV 177 Query: 194 MTIAPGLFGTPLLTSL-----PEKVC---NFLASQVPFPSRLGDPAEYAHLVQAIIENP- 244 IAP ++ TP+ PE++ +A +P +LGD A+ V A + +P Sbjct: 178 NAIAPAIW-TPMYDQTRSEMSPEQLSAHDALMARVIPLGGKLGDMAQDLVPVLAFLASPG 236 Query: 245 --FLNGEVIRLDGAIRM 259 F+ G++ +DG M Sbjct: 237 ARFMTGQIFAVDGGTLM 253 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory