Align 2-keto-3-deoxygalactonate kinase protein; EC 2.7.1.58 (characterized, see rationale)
to candidate Ac3H11_602 2-dehydro-3-deoxygalactonokinase (EC 2.7.1.58)
Query= uniprot:D8J0Z3 (319 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_602 Length = 349 Score = 325 bits (834), Expect = 8e-94 Identities = 175/321 (54%), Positives = 208/321 (64%), Gaps = 9/321 (2%) Query: 7 DCALIALDWGTSSLRCYRYDGSGQVVERRAHPWGIMNLP---AVEHGDDAQAPYRAALEA 63 + LIALDWGTS+LR +R G+V+E R PWGIMNLP A + A + AL+ Sbjct: 11 EAGLIALDWGTSALRAFRMGAHGEVLETRHRPWGIMNLPPTTASAADIEPGAAFERALQD 70 Query: 64 ACGDWIAAAPEAALIAAGMVGSKQGWREAAYLTVPLAPDGIGRKLTEVDTGLGRSLWIIP 123 CGDW+AA P L+A GMVGS QGWREA YL P + D + R LT + G L I+P Sbjct: 71 TCGDWLAATPGLPLLACGMVGSAQGWREAKYLPTPTSLDALARGLTLAERRDGPPLHIVP 130 Query: 124 GLLQNSALPNVMRGEETQVIGALQQ---QRQSELLIGLPGTHSKWVRVVEGRIEHFDTFM 180 GLLQ LPNVMRGEETQV+G L + +LIGLPGTHSKWV +G IE F TFM Sbjct: 131 GLLQQGTLPNVMRGEETQVLGVLAGLALRADGPVLIGLPGTHSKWVLARQGHIEQFHTFM 190 Query: 181 TGEVYGALCGHTILGRTMHKPDVPDDAAFVRGARVAQGPQGQAGVLSNIFSSRTLGLTGE 240 TGEV+ AL GHTILG+TM PDD AF RG VA+G G+LS+IFS+RTLGLTG Sbjct: 191 TGEVFAALRGHTILGKTMQAAVTPDDDAFARGLEVARGSDAALGLLSHIFSTRTLGLTGA 250 Query: 241 LAPEAQPDYLSGLLIGHEIAAL---KSLYPAQQAPIVLIGDAGLCRRYRLALELYGLGPV 297 LAP AQ DYLSGLLIGHE+A+L + P +VL G+ LCRRY +AL+ YG Sbjct: 251 LAPTAQADYLSGLLIGHEVASLSRAQDQTPTTPQTLVLCGEPDLCRRYAIALQTYGFAAP 310 Query: 298 SEADAATEAGLWILARHAGLV 318 + A AT GLW +A AGLV Sbjct: 311 TIATQATATGLWQIALAAGLV 331 Lambda K H 0.320 0.137 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 349 Length adjustment: 28 Effective length of query: 291 Effective length of database: 321 Effective search space: 93411 Effective search space used: 93411 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory