Align D-gluconate dehydrogenase cytochrome c subunit (EC 1.1.99.3) (characterized)
to candidate Ac3H11_2872 Putative diheme cytochrome c-553
Query= metacyc::MONOMER-12746 (434 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2872 Length = 426 Score = 306 bits (784), Expect = 8e-88 Identities = 174/411 (42%), Positives = 238/411 (57%), Gaps = 19/411 (4%) Query: 1 MKALVIATLALLGSAAANAAEADQQ--ALVQQGEYLARAGDCVACHTAKDGKPFAGGLPM 58 M A + TL L G A E Q ALVQ+GEYLAR G+C+ACHT + G PFAGG + Sbjct: 17 MAAAAVVTLNLRGEEPLPATETLQSTPALVQRGEYLARVGNCMACHTTQGGAPFAGGRGI 76 Query: 59 ETPIGVIYSTNITPDKT-GIGDYSFEDFDKAVRHGVAKGGSTLYPAMPFPSYARVSDADM 117 ETP GV++S+N+TPDK GIG ++ +F +A+ HG +K G LYPA P+P+Y +V+ D Sbjct: 77 ETPFGVVHSSNLTPDKAQGIGSWTSAEFWRAMHHGRSKDGRLLYPAFPYPNYTQVTREDS 136 Query: 118 QALYAYFMKGVAPVARDNQDSDIPWPLSMRWPLSIWRWMFAPSVETPAPAAGSDPVISRG 177 A++AY A VA N+ + +P + + L +WR +F + P P A +RG Sbjct: 137 DAIFAYLQSQPA-VAEPNRAHALRFPYNTQAALGVWRALFF-TPGAPQPEATQSAEYNRG 194 Query: 178 AYLVEGLGHCGACHTPRALTMQEKALSASGGSD-FLSGSAPLEGWIAKSLRGDHKDGLGS 236 AYLV GLGHC ACHTPR AL A+ + F G P++ W A +L H+ G+ Sbjct: 195 AYLVNGLGHCTACHTPR------NALGATTDAKAFTGGLIPVQNWYAPALNAAHEAGVKE 248 Query: 237 WSEEQLVQFLKTGRSDRSAVFGGMSDVVVHSMQYMTDADLTAIARYLKSLPANDPKDQPH 296 W + +V LKTG + + +V G M++VV S Q+++DAD A+A YL++LP Q H Sbjct: 249 WKTDDVVALLKTGVAPQGSVLGPMAEVVFRSAQHLSDADARAMAVYLQALP-----QQEH 303 Query: 297 QYDKQVAQALWNGDDSKPGAAVYIDNCAACHRTDGHGYTRVFPALAGNPVLQSADATSLI 356 + A A GA VY +CA CH G G FPALAGN + AD T+L+ Sbjct: 304 R--ALAAGAAPPASALARGAKVYEQHCAQCHGDQGQGEPGAFPALAGNRAVTLADPTNLV 361 Query: 357 HIVLKGGTLPATHSAPSTFTMPAFAWRLSDQEVADVVNFIRSSWGNQASAV 407 +VL+GG LPAT P MP F LSD+++A V +R+SWGN+A V Sbjct: 362 RVVLQGGYLPATAGNPRPHGMPPFQQLLSDEDIAAVTTLVRNSWGNRAPGV 412 Lambda K H 0.316 0.131 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 612 Number of extensions: 54 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 426 Length adjustment: 32 Effective length of query: 402 Effective length of database: 394 Effective search space: 158388 Effective search space used: 158388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory