Align 6-phosphofructokinase (EC 2.7.1.11) (characterized)
to candidate Ac3H11_779 Tagatose-6-phosphate kinase (EC 2.7.1.144) / 1-phosphofructokinase (EC 2.7.1.56)
Query= BRENDA::P06999 (309 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_779 Length = 318 Score = 187 bits (476), Expect = 2e-52 Identities = 121/302 (40%), Positives = 167/302 (55%), Gaps = 3/302 (0%) Query: 4 IYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGG 63 + TLTL P+LD AT T Q+ P KLRC GGGGINVAR + LG A GG Sbjct: 4 LITLTLNPALDLATTTAQVAPTHKLRCGPVQRFAGGGGINVARVLHRLGADVLAWALTGG 63 Query: 64 ATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEE 123 A G + LLADE VP A TR+N V +G+++RFV+PG L E++ + Sbjct: 64 AAGAQVQQLLADEGVPTALQAIAGDTRENFSVVETITGQEFRFVLPGPTLQAAEWQACLD 123 Query: 124 QVLEIES-GAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIE 182 + + + L+ SGSLPPG + +L A +G+R +VD+SG L+AAL G + Sbjct: 124 ALAALPTPPRWLIASGSLPPGTPDDFYARLARALSGRGVRMVVDTSGPPLAAALQAG-VA 182 Query: 183 LVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVV 242 LVKP+ +EL LV + L Q D AAQ +V+SG A+ V +SLG QGA+ Q Sbjct: 183 LVKPSLRELRELVQQPLEQAADWCAAAQSLVHSGAAETVALSLGEQGAVLATRTGVWQAP 242 Query: 243 PPPVKSQS-TVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQ 301 + + + T GAGD + A+ L + E +R+GVAAG+AA L+ GT L D Q Sbjct: 243 ALNMPATTGTTGAGDCFLAALVWALDRGDAPAEALRWGVAAGAAALLHPGTTLAQAGDLQ 302 Query: 302 KI 303 ++ Sbjct: 303 RL 304 Lambda K H 0.314 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 318 Length adjustment: 27 Effective length of query: 282 Effective length of database: 291 Effective search space: 82062 Effective search space used: 82062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory