Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate Ac3H11_4115 Aromatic-amino-acid aminotransferase (EC 2.6.1.57)
Query= CharProtDB::CH_004054 (397 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4115 Length = 398 Score = 397 bits (1021), Expect = e-115 Identities = 205/397 (51%), Positives = 263/397 (66%), Gaps = 1/397 (0%) Query: 1 MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60 +F V+ DPIL L E+F D +KVNL +G+Y++++G +P LQ V AE + + P Sbjct: 3 LFTAVEMAPRDPILGLNEQFNADTNPNKVNLGVGVYFDDNGKLPLLQCVQAAEKTMMSTP 62 Query: 61 HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120 YLP++G+ Y +A+ L+FGAD + RVAT+Q +GG+G LK+GADFLK+ P Sbjct: 63 TARG-YLPIDGIVAYDNAVKSLVFGADSEPVTSGRVATVQAIGGTGGLKIGADFLKKVSP 121 Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180 + V +SDP+WENH A+F AGFEV TY +YD GV F LA+L +IV+LH Sbjct: 122 SAKVLISDPSWENHRALFTNAGFEVDTYAYYDAEKRGVNFEGFLASLNAAAPGTIVVLHA 181 Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240 CCHNPTG D+T QWD VI +KA+ L PFLD+AYQGFG G+ ED I +AGL Sbjct: 182 CCHNPTGYDITAAQWDQVIAAVKAKGLTPFLDMAYQGFGHGIAEDGAVIGKFVAAGLNFF 241 Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300 VS SFSK FSLYGERVGGLSV+C D E A RVL QLK +R NYS+PP G VVAAVLN Sbjct: 242 VSTSFSKSFSLYGERVGGLSVLCADKEEASRVLSQLKIVIRTNYSNPPIHGGAVVAAVLN 301 Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360 + L+A W E+ EMR RI AMRQ+LV L +++ ++ Q GMFSY+GLS Q+ Sbjct: 302 NPELRAMWEQELAEMRVRIKAMRQKLVDGLKAAGVKQDMSFITTQIGMFSYSGLSKDQMV 361 Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 RLR EFGVY +GRMCVA LN+ N+ V +A A V+ Sbjct: 362 RLRNEFGVYGTDTGRMCVAALNSKNIDYVCQAIAKVV 398 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 398 Length adjustment: 31 Effective length of query: 366 Effective length of database: 367 Effective search space: 134322 Effective search space used: 134322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory