Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate Ac3H11_2775 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2775 Length = 279 Score = 175 bits (444), Expect = 8e-49 Identities = 107/255 (41%), Positives = 145/255 (56%), Gaps = 3/255 (1%) Query: 5 KVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGA 64 +V+ RG + ++ + NAI+ + + + + + S VR +VI GAG + FCAGA Sbjct: 25 EVERRGGVGWIVLNRPDQINAINDDIRRGVPAALAELDSDPSVRVIVIRGAGARGFCAGA 84 Query: 65 DLKER-ATMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAA 123 D+KER A +VR + R A+++++ IAAI+G +GGG ELALACDLR AA Sbjct: 85 DIKERRAAETSVQVRRRMQK-SRWIEALDRTEKPVIAAIHGYCMGGGMELALACDLRFAA 143 Query: 124 PAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPE 183 A L E LG+IPGGGGTQRL +VGPGRA DL+LT R++A AF +GL R+A Sbjct: 144 SDAVFALPETGLGLIPGGGGTQRLGAVVGPGRALDLLLTGDRVDARRAFDIGLITRMADS 203 Query: 184 G-HLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRLE 242 LLA LAE + + P A AK A L+L L LEL + ++ D E Sbjct: 204 ADSLLAEVTALAERIAQKPPTATLFAKQAARAACHLDLKSGLDLELDLFAMLVPMNDVKE 263 Query: 243 GLRAFAEKRAPVYKG 257 AF EKRAP + G Sbjct: 264 AALAFREKRAPCFSG 278 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 279 Length adjustment: 25 Effective length of query: 233 Effective length of database: 254 Effective search space: 59182 Effective search space used: 59182 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory