Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate Ac3H11_3213 Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)
Query= TCDB::Q8DQH7 (236 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3213 Length = 236 Score = 213 bits (541), Expect = 3e-60 Identities = 116/232 (50%), Positives = 156/232 (67%), Gaps = 3/232 (1%) Query: 4 LKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFL 63 L V+NL+ Y Q ++D+S + G V ++G NGAGKTT+L+ L+GL+ P +G + Sbjct: 6 LTVQNLTTGYHGFQVLQDLSLQAAPGITV-IVGPNGAGKTTLLKALAGLL-PRTGTVALD 63 Query: 64 GQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRF 123 G ++ M A V GL+ V EGR +FP +TV ENLE+G +L +R L + F F Sbjct: 64 GSDLPAMNATACVQRGLALVAEGRQLFPQMTVTENLELGGWLVPSRTRAD-RLAQAFEDF 122 Query: 124 PRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQ 183 PRL+ER Q A T+SGGEQQM+A+ RALMS P+LL+LDEPS+GLAP + E+ I+Q I Sbjct: 123 PRLKERATQLAGTMSGGEQQMVAVARALMSGPRLLMLDEPSLGLAPRMVDELLAIVQRIA 182 Query: 184 KQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 QG TVL++EQN KAL I+ RGYVLE G+IV SG +L S+ VR+AYLG Sbjct: 183 AQGVTVLMVEQNVRKALQIAQRGYVLERGRIVASGAASDLLQSDVVRQAYLG 234 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 236 Length adjustment: 23 Effective length of query: 213 Effective length of database: 213 Effective search space: 45369 Effective search space used: 45369 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory